Details for Kale Locus Bo2g082440

Position : C2 ( 5`- 23117789 .. 23121208 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo2g082440

Protein [Map View]
MSDLDLASGMILVKRTLRGDERRWKSEEKTMRHATVERDERGAEFIEVQGPSSLWLVCWICFCALRSKGSLAVAVLLRPF
SFEGRRHIDIEILLQEDLVTLDEVLRNANNAVSMAVNAVSALISISILLSLMGMHANFIEVTHKDLKELEASEVTTVGFG
AGHNLKTSILQAIFDCPFFRPGIKDLNAIICIVASSVALHKKDVKTILPTFRQVMEYTGDIIVSTVHEPDLEPKQRKLPA
KTTCFSGLIPFVLNIFEKYRSQLQKETSSGLGDVLVAIEDAADSTDVRSSSQSVEGLETDSEELPGVSVSENGDNYGSIQ
REPIANWSMDPGHKIEQNRVADSGDTTVLSLAIVNLPVGVRPSKNLNGSLSVTSQPSRNAERDSSKRWSPIIGMQYRGEL
FKGRCQGGLSEGKGRLVFGDGSIYDGMWHKGKRCGLGTFYFKNGDVFQGTWSEDLIHGK

DNA
ATGTCAGATTTAGATCTAGCCTCAGGAATGATTCTGGTGAAGAGGACACTAAGAGGAGATGAGAGAAGATGGAAAAGCGA
AGAAAAAACAATGAGACATGCCACTGTGGAGAGAGACGAGCGTGGAGCTGAGTTCATTGAGGTCCAAGGGCCTTCATCCT
TGTGGCTAGTGTGCTGGATATGTTTCTGTGCATTGAGATCTAAAGGTAGCTTAGCTGTTGCTGTGCTATTAAGGCCTTTC
AGCTTTGAAGGGCGAAGGCATATAGACATAGAGATTTTACTACAAGAGGATTTGGTAACTCTGGACGAGGTGCTAAGAAA
TGCAAACAATGCTGTTTCGATGGCAGTAAATGCCGTCTCTGCTCTGATAAGTATAAGCATACTTTTGTCTCTCATGGGGA
TGCATGCAAACTTTATAGAGGTGACGCATAAAGATCTTAAAGAACTTGAAGCTTCAGAAGTCACAACAGTTGGTTTTGGA
GCTGGTCACAACCTCAAGACTTCTATTTTACAAGCTATATTCGACTGCCCTTTCTTTCGCCCTGGTATAAAGGATTTAAA
CGCTATTATATGCATTGTGGCTAGCTCTGTAGCTCTTCACAAGAAGGACGTGAAAACAATTCTTCCTACTTTTCGTCAAG
TAATGGAGTACACTGGAGATATCATAGTATCTACTGTTCATGAGCCTGACCTGGAGCCTAAACAGAGGAAACTTCCAGCA
AAGACAACATGTTTTTCTGGTCTTATTCCATTTGTTTTGAATATATTCGAGAAGTATCGTTCACAACTCCAAAAAGAAAC
AAGTAGTGGACTTGGAGATGTGCTGGTTGCAATAGAAGATGCAGCAGACTCTACTGATGTTAGAAGTTCCAGTCAGAGTG
TTGAAGGACTAGAAACTGACTCTGAGGAACTCCCAGGAGTTTCAGTTTCAGAGAATGGTGATAATTATGGTTCTATCCAG
AGGGAGCCAATTGCTAACTGGAGTATGGATCCAGGACATAAGATTGAGCAGAATAGGGTAGCCGATTCTGGAGACACTAC
TGTGCTTAGCCTGGCTATTGTAAACCTTCCTGTTGGTGTGAGACCTTCAAAGAATTTGAACGGTAGTCTCAGTGTCACCA
GTCAACCCTCTAGGAATGCTGAACGAGATTCATCAAAAAGATGGAGTCCTATAATAGGGATGCAGTACAGAGGAGAACTG
TTCAAGGGAAGATGCCAAGGAGGCCTTTCTGAAGGAAAGGGTCGTTTGGTATTTGGAGATGGAAGCATATATGATGGAAT
GTGGCACAAGGGTAAAAGATGTGGTCTTGGAACATTCTACTTCAAGAATGGAGACGTGTTCCAAGGCACATGGAGTGAAG
ATTTAATACACGGAAAG