Details for Kale Locus Bo2g082430

Position : C2 ( 5`- 23114001 .. 23116673 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo2g082430

Protein [Map View]
MVAASSCYAYLDFRPYNHYNSNNIIIALSSLFGSNSISLNRNQSRLNRATNSGRAMAIAMNMENEAMVSKNNPPMEKRRV
VVTGMGVETSLGYDPHTFYENLLQGNSGISHIEDFDCSNFPTAISKYYYYIKTFLRIAGEIKSFSTEGWVAPKLSRRMDK
FMLYLLTAGKKALADGGVTEQVMAEFDKAKCGILIGSALGGMKVFHEAIQAFKISYKKMNPFCVPLATTNMGSAMLAIDL
VWSGLNGWMGTNYSISSACATSNFCILNSANHIIKGEADVMLCGGSDAAIIPIGLAGFVAVRALSQRNNDPAKASRPWDC
NRDGFVMGEGAGVLLLEELEHAKKRGATIYAEFLGGSFTCDAYHMTEPHPDGAGVIICIERALAHAGITKEQINYVNAHA
TSTPAGDLKEYKALVHCFGQNPELKVNSTKSMIGHLLGAAGAVEAVATVQAIRTGWVHPNINLDNPENGVDTKLLVGSKK
ERLDIKAALSNSFGFGGHNSSIIFAPYK*

DNA
ATGGTGGCTGCCTCTTCCTGTTACGCCTATTTGGACTTTAGGCCTTACAATCACTACAACAGCAACAATATCATTATTGC
CTTGTCTTCTCTCTTCGGATCAAATAGTATTTCTTTGAATCGAAACCAGAGTAGACTTAACCGAGCAACTAACTCCGGTA
GAGCCATGGCTATTGCTATGAATATGGAAAATGAAGCCATGGTTAGCAAGAATAATCCCCCTATGGAGAAGCGTCGGGTT
GTGGTGACAGGCATGGGAGTTGAAACATCATTAGGTTATGACCCACATACCTTTTACGAGAACTTGCTACAAGGCAACAG
TGGTATTAGCCACATTGAGGATTTTGATTGTTCCAACTTTCCTACGGCAATAAGCAAATATTATTATTATATTAAGACTT
TCTTGAGAATCGCGGGTGAGATCAAATCTTTCTCAACTGAAGGATGGGTTGCTCCTAAACTGTCTAGGAGGATGGACAAG
TTCATGCTCTATCTTCTCACTGCTGGCAAGAAAGCTTTGGCTGATGGTGGTGTAACCGAACAAGTCATGGCTGAGTTTGA
CAAAGCCAAATGTGGCATTTTGATTGGCTCTGCACTGGGTGGCATGAAGGTCTTTCATGAGGCTATTCAAGCTTTCAAGA
TCTCTTACAAGAAGATGAATCCTTTTTGTGTTCCTCTTGCTACAACTAACATGGGTTCTGCTATGCTCGCTATTGATCTG
GTCTGGTCTGGTCTAAATGGGTGGATGGGGACAAACTACTCTATATCAAGTGCTTGTGCTACAAGCAACTTTTGCATTCT
GAATTCAGCTAACCACATTATTAAGGGTGAAGCTGATGTAATGCTCTGTGGTGGCTCAGATGCAGCTATTATTCCAATAG
GGTTGGCAGGTTTCGTGGCAGTCCGGGCTCTTTCACAAAGGAATAATGATCCCGCAAAAGCTTCACGTCCTTGGGATTGT
AATCGAGATGGTTTCGTGATGGGGGAGGGAGCTGGAGTTCTGCTTTTGGAAGAACTTGAGCATGCTAAGAAAAGAGGAGC
AACTATCTACGCAGAGTTCCTTGGTGGGAGCTTCACATGTGATGCCTACCACATGACCGAGCCTCACCCTGATGGAGCTG
GTGTGATTATATGTATTGAGAGAGCGTTAGCTCATGCTGGGATTACCAAGGAACAGATAAATTACGTGAATGCACATGCA
ACCTCAACACCAGCTGGAGACCTTAAGGAGTACAAAGCCCTTGTTCACTGTTTTGGTCAAAATCCTGAGCTAAAGGTAAA
CTCCACGAAATCTATGATCGGACACTTGCTGGGAGCTGCTGGAGCTGTAGAGGCTGTTGCAACCGTGCAGGCAATAAGAA
CCGGTTGGGTTCATCCAAATATCAACCTAGACAATCCAGAGAATGGAGTGGATACAAAATTACTGGTGGGCTCTAAGAAG
GAGAGATTGGACATTAAAGCAGCCTTGTCAAATTCTTTTGGGTTTGGTGGTCATAACTCCAGCATCATTTTTGCTCCTTA
CAAGTGA