Details for Kale Locus Bo2g082390

Position : C2 ( 5`- 23079498 .. 23082272 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo2g082390

Protein [Map View]
MGSSTEEKVVAVILVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQVYLVGFYEEREFALYVSAISN
ELKVPVRYLREDKPHGSAGGLYHFRNLIMEDNPSHIFLLNCDVCCSFPLPEMLEAHRKYGGIGTLLVIKVSPESASQFGE
LVADPVTNELLHYTEKPETFVSDRINCGVYVFTPEIFTAIRDVSSQRNDTATLRRVSSYEALQPATRIPADFVRLDQDIL
SPLAGKKQLYTYETMDFWEQIKSPGMSLRCSELYLSQFRLTSPHMLASGDGTKSAIVIGDVYIHPSAKVHPTAKIGPNVS
ISANARVGPGVRLISCIILDDVEIMENAVVTNAIVGWKSSIGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVTSSIVL
PNKTLNVSVQDEIIL*

DNA
ATGGGAAGCTCAACGGAGGAGAAAGTTGTGGCCGTGATCTTGGTCGGTGGTCCGACCAAAGGTACTCGATTCCGACCATT
GTCCCTGAACATTCCAAAGCCTCTGTTTCCCATTGCTGGACAGCCAATGGTGCATCACCCTATCTCTGCTTGTAAAAGGA
TTCCAAACTTAGCTCAAGTCTATCTTGTTGGCTTCTATGAGGAAAGGGAGTTTGCACTTTACGTCTCTGCCATTTCCAAT
GAACTCAAAGTCCCTGTCAGATATCTGAGAGAAGACAAGCCACATGGTTCTGCTGGTGGGTTGTATCACTTTAGAAACCT
AATCATGGAAGATAACCCGTCTCATATCTTCCTACTTAACTGTGATGTTTGCTGTAGTTTCCCCTTGCCAGAAATGCTCG
AGGCTCATAGGAAATATGGTGGGATTGGAACTCTTCTAGTCATCAAGGTCTCTCCTGAGTCAGCAAGCCAATTTGGAGAA
CTGGTTGCAGATCCAGTTACTAATGAGCTGCTTCATTACACCGAGAAACCCGAAACCTTTGTCAGTGACCGTATTAACTG
CGGTGTTTATGTATTCACACCTGAAATTTTTACTGCTATAAGAGATGTTTCCTCTCAAAGGAATGATACAGCGACTCTGA
GACGTGTTTCCAGCTATGAAGCTCTTCAACCGGCAACAAGGATCCCGGCAGATTTTGTAAGATTGGATCAAGACATCCTC
TCACCTTTAGCTGGGAAGAAACAGCTCTATACTTATGAGACTATGGATTTCTGGGAGCAAATTAAATCTCCTGGAATGTC
GCTGAGGTGCTCGGAACTTTATCTATCCCAGTTCCGGTTAACCTCTCCCCACATGTTGGCTAGTGGTGATGGAACAAAGA
GTGCCATAGTGATTGGTGATGTTTACATACATCCTTCTGCAAAAGTACACCCAACTGCAAAGATTGGTCCCAACGTCTCA
ATCTCTGCAAATGCCCGTGTTGGACCGGGTGTGAGGCTTATCAGCTGTATCATTCTTGACGACGTTGAGATCATGGAAAA
TGCAGTGGTGACAAATGCTATCGTCGGTTGGAAATCTTCAATCGGGAGATGGTCCCGTGTCCAGGCTGAGGGAGTCTACA
ATTCCAAACTTGGAGTTACAATTCTCGGAGACTCGGTTGCAGTTGAAGACGAGGTTGTGGTGACCAGCAGTATTGTTCTT
CCAAATAAGACTCTCAACGTTAGTGTTCAAGACGAGATAATCTTGTAA