Details for Kale Locus Bo2g082380

Position : C2 ( 5`- 23077983 .. 23078789 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo2g082380

Protein [Map View]
MVADSITEDSQLSHGSPITRDVFKKRKAYLLRKLKQCKVDGAHQWTVEDDETVVISDNSSDDDYSDALSMFNEEEDPSES
NNKSSSTTEKPEPPSPEEKATDEEKEDDDCPLCAEKMDATDLLFEPCSSCEYKMCLFCYNKIKVGTGVCPGCRTKYEQQT
SSNSGEVSFQQRGGDPIRLSSSFQGLDDDSA*

DNA
ATGGTTGCTGATTCCATCACCGAGGATTCTCAACTCTCTCATGGCTCTCCGATCACGAGAGATGTCTTCAAGAAACGAAA
GGCGTATCTGTTAAGGAAGCTGAAACAGTGCAAGGTTGATGGTGCTCATCAATGGACTGTTGAAGACGATGAGACTGTTG
TTATCTCTGACAACTCTAGCGATGATGATTACAGCGATGCCTTAAGCATGTTCAACGAAGAAGAAGATCCAAGCGAGAGT
AACAACAAGTCGTCTTCTACAACTGAAAAGCCAGAACCTCCTTCACCAGAAGAGAAGGCTACCGATGAGGAGAAAGAAGA
TGATGACTGTCCCCTTTGCGCTGAAAAGATGGATGCAACGGATCTACTCTTCGAACCATGTTCTTCTTGCGAGTATAAGA
TGTGTCTCTTCTGCTATAACAAGATCAAAGTAGGCACTGGAGTTTGCCCAGGTTGCAGGACCAAGTATGAGCAGCAGACA
AGTAGTAACAGCGGAGAAGTGAGTTTCCAGCAACGTGGGGGTGACCCAATCCGTTTGTCTTCATCGTTTCAGGGACTTGA
TGATGATAGTGCTTAA