Details for Kale Locus Bo2g082370

Position : C2 ( 5`- 23069006 .. 23069877 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo2g082370

Protein [Map View]
MADGSNTVACGISKEIMLFGVRVVLDPMRKSVSLNNLSDYEQTKEILKIGGEDGDGQDMNKTNSCYASADEAVPVSSNRE
RKRGVPWSEEEHKLFLLGLEKVGKGNWKGISKNFVKTRTSTQVASHAQKYFLRRSNLNRRRRRRSSLFDMTTPTVMPMEE
VQENSSQPSSLVPEVNLVPFTSQAWSEPISLSLSLAISNINEPSSSYSRHSAFNTIGVA*

DNA
ATGGCCGACGGTAGTAACACGGTCGCGTGCGGAATAAGTAAAGAGATTATGCTGTTTGGTGTTAGGGTTGTGCTTGACCC
TATGAGAAAGAGCGTGAGTTTGAACAACTTGTCTGATTATGAGCAGACGAAGGAGATCCTAAAGATCGGTGGCGAGGATG
GAGATGGACAAGATATGAACAAAACCAACTCCTGTTACGCTTCCGCGGATGAAGCTGTTCCGGTTTCTTCTAACCGTGAG
AGGAAACGAGGAGTTCCATGGAGTGAGGAAGAGCACAAGCTGTTCTTGCTTGGTCTGGAGAAAGTAGGAAAAGGAAATTG
GAAAGGAATATCTAAAAACTTTGTCAAGACCAGAACGTCTACTCAAGTAGCTAGTCATGCTCAGAAATACTTTCTCCGGC
GAAGTAATCTCAACCGTCGCCGCCGGAGAAGATCTAGCCTTTTTGACATGACAACTCCTACGGTCATGCCCATGGAAGAA
GTGCAGGAGAACTCATCACAACCATCTTCTCTTGTACCAGAAGTTAACCTGGTCCCATTTACTTCGCAAGCTTGGTCTGA
ACCGATCTCTCTCAGCCTCTCACTAGCCATATCTAATATAAATGAGCCATCATCTTCTTATTCAAGGCATTCAGCATTCA
ACACCATTGGAGTCGCTTAA