Details for Kale Locus Bo2g082360

Position : C2 ( 5`- 23066730 .. 23068004 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo2g082360

Protein [Map View]
MTQSATLTRRKPLPLLIAMSTRNYLRSNIYMCEGCLLSFATQKESDCDTYKKLLKTKSEKFSKNNTCLLAPSPAPAPSPT
VSHNKVSEKESEFKDLDVDRTPSFVRGVHDGWSVRALRKSPLDKIDIADSNGESILHQLKKEREIWMMTPREKSFLKNTV
FLGQTAIAKRPNQSLILQFVLQIMPKHRSKWSCNTEESSVLVQMKSLEDWTSERDVLDVSEGEAILVQISQNLHVLRCFV
AMPSES*

DNA
ATGACTCAATCTGCGACTCTCACAAGAAGAAAGCCTCTTCCCTTGCTTATTGCCATGTCCACAAGAAACTATCTGAGATC
AAACATATATATGTGTGAAGGTTGTCTTCTCTCTTTCGCCACCCAGAAAGAATCTGACTGTGATACTTATAAAAAACTAT
TAAAGACAAAATCTGAGAAGTTTTCAAAGAACAACACTTGTTTACTTGCTCCTTCTCCTGCTCCTGCTCCTTCTCCTACG
GTTTCACACAACAAAGTTTCTGAAAAAGAATCTGAATTTAAGGATCTGGATGTGGACAGAACACCAAGTTTTGTAAGAGG
AGTCCACGATGGATGGTCCGTACGAGCTCTCAGGAAATCACCTTTAGATAAGATAGACATCGCTGATTCAAACGGTGAAT
CCATCCTTCACCAGCTCAAGAAAGAGAGAGAGATATGGATGATGACGCCTCGAGAGAAGAGTTTCTTGAAGAACACTGTA
TTTCTAGGGCAGACTGCGATTGCCAAAAGACCAAACCAGTCTCTGATATTGCAGTTTGTTCTTCAAATCATGCCAAAACA
TCGATCAAAATGGTCTTGTAATACCGAAGAATCGAGTGTTTTAGTACAAATGAAAAGTTTAGAGGACTGGACTTCAGAAA
GAGATGTTTTAGATGTTAGTGAAGGAGAAGCAATTCTAGTGCAGATATCTCAAAATTTGCACGTGCTTCGTTGTTTTGTT
GCTATGCCTTCAGAATCATGA