Details for Kale Locus Bo2g082320

Position : C2 ( 5`- 23024042 .. 23028284 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo2g082320

Protein [Map View]
KSLVSYYKHQNLQIKQNIYKFTHHLCFFRSPMASLQLSSHFLGTNTKKHSSMSISRTYSPVPCTRLFSRKFMSCSMSMNG
CEGDFKTPLGTVETRTMAAVLSPTSATESLISAVSELKCQPPPFSSGVVRLEVPINQQIRAIDWLQAQNETHPRCFFSRR
SDVGRPDLLLDLASEKDNNNGGSSDRDLVSVAGIGSAVFFRDLDPFSHDDWRSIRRFLSSTSPLIRAYGGMRFDPNGKIS
VEWKPFGAFYFAVPQVEFNEFEGSSMLAATLAWDDELSWTLDNAVESLQETMLQVSSIVMKLRKESLGVSVLSKNHVPTK
GAYYPAVEKALEMINQKSSSLNKVVLARNSRVITDTDIDPIAWLAQLQSEGHDAYQFCLQPPGAPAFIGNTPERLFQRNQ
LGVCSEALAATRPRGASTARDKEIELDLLTSLKDDLEFSIVRENIKEKLNSICDKVVVKPQKTVRKLARVQHLYSQLAGR
LRREDDEFDILAALHPTPAVCGLPAEEARLLIKEIESFDRGMYAGPIGFFGGQESEFAVGIRSALVEKGLGALIYAGTGI
VAGSNPTSEWNELDLKISQFTKSIEYKSTSLQRIN*

DNA
AAATCTCTAGTCTCTTACTACAAACATCAAAACTTACAAATCAAACAAAATATTTATAAGTTCACTCACCATCTCTGTTT
CTTTCGTTCTCCAATGGCCTCACTTCAACTCTCCTCTCACTTTCTTGGCACAAACACTAAGAAACACAGCTCCATGTCCA
TCTCTCGTACTTACTCTCCTGTCCCATGCACCAGATTATTCTCCCGCAAGTTTATGTCGTGTTCCATGTCTATGAATGGA
TGCGAAGGTGATTTCAAGACGCCACTTGGTACAGTTGAGACGAGGACTATGGCGGCAGTTTTATCTCCAACATCCGCCAC
TGAGAGTCTAATCTCCGCCGTCTCCGAGCTTAAGTGTCAACCTCCGCCATTTTCCTCCGGCGTCGTCCGCTTAGAGGTAC
CAATCAACCAGCAAATCAGAGCAATCGATTGGCTTCAAGCCCAGAACGAGACTCATCCTCGCTGCTTCTTCTCTCGCCGT
AGCGACGTTGGTCGTCCTGATCTTCTTCTCGACTTAGCGAGCGAGAAGGATAACAATAACGGAGGCTCATCAGATCGTGA
TCTGGTCAGCGTTGCTGGTATCGGTTCAGCAGTGTTCTTCCGTGACCTTGACCCGTTCTCTCATGATGACTGGAGATCCA
TCAGAAGGTTTCTGTCGTCTACGTCACCTTTGATTCGTGCCTATGGTGGCATGAGGTTTGATCCTAACGGCAAGATCTCT
GTGGAGTGGAAACCTTTTGGTGCATTCTACTTTGCAGTGCCTCAGGTTGAGTTTAATGAGTTTGAGGGAAGCTCAATGTT
GGCTGCAACTCTTGCTTGGGACGATGAACTCTCTTGGACTTTGGATAATGCCGTTGAATCACTTCAAGAGACTATGCTCC
AGGTTTCTTCTATTGTGATGAAGTTGCGGAAGGAATCTTTAGGAGTATCTGTTCTTAGCAAGAACCATGTTCCTACAAAA
GGAGCGTATTACCCTGCCGTAGAGAAGGCTTTGGAGATGATAAATCAAAAGAGTTCATCCCTTAACAAGGTTGTGCTTGC
TCGCAACAGCAGAGTGATAACAGATACCGACATTGATCCCATCGCATGGCTTGCACAGTTACAGAGTGAAGGGCATGATG
CGTATCAGTTCTGTCTCCAGCCACCAGGTGCACCTGCTTTTATCGGAAACACGCCTGAGAGACTTTTCCAAAGGAATCAG
TTAGGCGTCTGCAGTGAAGCTTTGGCTGCAACTAGGCCTCGAGGTGCTTCAACGGCTCGCGATAAGGAGATAGAGCTTGA
CTTACTAACCAGCCTGAAGGACGACCTTGAGTTCTCTATTGTACGAGAGAACATAAAAGAAAAGTTGAACTCTATATGTG
ACAAGGTAGTTGTTAAGCCCCAAAAAACTGTGAGGAAGCTTGCAAGAGTGCAGCACTTGTATTCTCAATTGGCAGGGAGG
CTTAGGAGGGAAGATGATGAGTTTGACATCTTGGCTGCTCTACATCCAACTCCAGCTGTTTGTGGGCTTCCAGCTGAAGA
AGCCAGGCTTTTAATTAAGGAGATAGAGTCATTCGATAGAGGAATGTACGCGGGACCTATTGGCTTTTTTGGTGGCCAGG
AGAGTGAGTTTGCAGTTGGGATCAGATCAGCTCTAGTCGAAAAGGGTCTTGGAGCATTGATCTACGCAGGGACAGGGATA
GTAGCAGGAAGCAACCCAACCTCAGAGTGGAATGAGCTTGATCTAAAGATATCTCAGTTTACCAAGTCAATTGAATATAA
GTCAACAAGTCTACAGAGGATTAATTGA