Details for Kale Locus Bo1g119350

Position : C1 ( 5`- 36000423 .. 36006218 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo1g119350

Protein [Map View]
MRKACLNPDRVVEHELQEAGFSPESEKATNKHHEEEEEEEEEEEESVEKIFESREVPSWTKQLTLRAFVVSFVLSILFSF
IVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKMLHRSGYLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIA
KQSGDVARGVKNPSLGWIIGFLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRVLGKF
FSFSFLWSFFQWFFTGGENCGFSNFPTFGLKAYQYKFYFDFSATYVGVGMICPYIINISVLLGGILSWGIMWPLIETKKG
DWFPADVEPSSMHGLQAYKVFIAVAIILGDGLYNFCKVLSRTLSGLFVQLRGTTTPSFSRRSFTVQEEEDPHASPQTPKE
SYDDQRRTRFFLKDQIPTWFAVGGYITISAASTAILPYMFHQLRWYYILVIYICAPVLAFCNAYGAGLTDWSLASTYGKL
AIFTIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTGYLTLSSPKSMFVSQVIGTAMGCVVSPCVFWLFYKAFE
DLGIPNSEYPAPFATVYRSMAKLGVEGVASLPRECLVLCYAFFSVAILVNIVKDSLPSRWGRFVPLPMAMAIPFFLGPYF
AIDMCVGSLVLFVWERVDAAKAEAFGTAVASGLICGDGIWSFPSSVLAIAGVNPPVCMKFLSAATNSRVDSFLKRSMNGK
ASVSKELNAKHSKILEALLKQPDNRECADCRSKAPRWASVNLGIFICMQCSGIHRSLGVHISQVRSITLDTWLPDQVSFM
QSTGNAKANQYWESELPLHFERSSSDSFIRAKYNEKKWVSPGGIQPSPIASQLSCKVSHLVESGYKPATPKKARTLSLDE
DLLLKHVLQVTPPETRIRAGSVDMKENVYALPLPVGMEAKKPNQKNEIFSGEMYQNRSTTIAPPSSWATFDCKANFSFFY
LIYEISTQMAASACLRLPAAMAVRREEGAPNSKSSQEKPRIYLNKPSWIVTTQCGAKTSRKEKGRCVICHGTGRVDCFNC
SGKGRTNCVDMEMLPRGEWPKWCRSCGGSGLCECSRCLGTGEYRYIMGFRFLNKHDDVDPQL*

DNA
ATGAGAAAGGCGTGTCTAAATCCAGACAGAGTTGTGGAACACGAGTTGCAGGAAGCTGGGTTTAGTCCAGAATCTGAGAA
GGCGACGAATAAGCATCATGAAGAGGAAGAGGAAGAGGAAGAGGAAGAGGAGGAATCTGTGGAGAAGATCTTTGAAAGCA
GAGAAGTACCTTCTTGGACAAAGCAGCTGACTTTGAGGGCTTTTGTGGTGAGCTTTGTGCTAAGCATCTTGTTTAGCTTC
ATTGTTATGAAGCTTAACCTCACGACGGGAATCATACCGTCGCTCAATGTCTCAGCTGGTCTTCTGGGTTTCTTCTTTGT
CAAGACGTGGACCAAGATGCTTCATAGGTCTGGATACTTGAAACAGCCGTTTACTCGCCAGGAGAACACTGTTATTCAGA
CCTGCGTTGTTGCTTCTTCCGGCATTGCCTTCAGCGGAGGGTTTGGGACATACCTATTTGGCATGAGTGAACGAATTGCA
AAGCAATCAGGAGACGTTGCTCGTGGCGTCAAGAACCCTTCATTGGGTTGGATTATTGGTTTCCTCTTTGTTGTCAGCTT
TCTTGGCCTCTTCTCAGTTGTTCCCCTTAGGAAGATAATGGTAATAGACTTCAAACTAACATATCCAAGTGGTACTGCTA
CTGCTCATCTTATCAACAGCTTCCATACACCTCAAGGAGCCAAGCTAGCCAAGAAACAAGTGAGGGTATTGGGGAAGTTC
TTCTCCTTCAGCTTCTTGTGGAGTTTCTTCCAATGGTTCTTTACCGGAGGAGAAAATTGTGGGTTCTCCAACTTCCCTAC
CTTTGGACTCAAAGCTTATCAATACAAGTTCTACTTTGATTTTTCAGCAACATATGTGGGTGTTGGCATGATATGCCCAT
ACATAATCAACATCTCTGTTCTCTTGGGAGGGATCCTCTCTTGGGGTATAATGTGGCCTCTCATTGAAACCAAAAAGGGA
GATTGGTTTCCTGCAGATGTCGAACCTAGCAGCATGCATGGTCTCCAGGCTTACAAGGTGTTCATAGCTGTTGCTATAAT
CCTAGGAGACGGCTTATACAACTTCTGCAAGGTGCTGAGCCGGACACTATCAGGACTATTTGTACAGCTCCGAGGTACTA
CTACTCCATCTTTCTCAAGAAGATCTTTCACAGTCCAAGAAGAAGAAGACCCTCATGCTTCCCCACAAACCCCAAAAGAA
TCATACGACGACCAACGCCGCACGAGATTCTTCCTCAAAGACCAAATCCCCACTTGGTTCGCCGTCGGAGGATACATCAC
CATCTCCGCAGCATCAACCGCCATACTCCCGTACATGTTCCACCAGCTCAGATGGTACTACATCCTCGTCATCTACATCT
GCGCGCCGGTCCTAGCCTTCTGCAACGCCTACGGAGCCGGACTCACAGACTGGTCCTTGGCCTCAACATACGGCAAACTC
GCCATATTCACGATAGGAGCGTGGGCGGGCTCCGAGCACGGCGGCATGCTGGCTGGACTAGCTGCGTGCGGCGTCATGAT
GAACATAGTCTCCACAGCTTCGGACCTCACGCAGGACTTCAAAACAGGATACCTCACTCTCTCATCACCCAAGTCAATGT
TTGTATCCCAAGTGATTGGCACGGCGATGGGCTGCGTCGTCTCACCTTGCGTGTTCTGGCTGTTCTACAAGGCCTTCGAG
GACTTAGGCATCCCGAACAGCGAGTACCCCGCCCCGTTCGCTACAGTTTACCGAAGCATGGCCAAGCTAGGAGTCGAAGG
TGTTGCTTCTTTACCAAGAGAGTGTTTAGTTCTTTGCTACGCGTTTTTCAGCGTGGCGATTCTTGTGAACATAGTGAAGG
ATAGTTTGCCGAGCAGGTGGGGGAGGTTCGTGCCGCTGCCGATGGCGATGGCGATACCATTTTTCTTGGGGCCGTACTTT
GCGATTGACATGTGCGTGGGGAGTTTGGTGCTTTTCGTTTGGGAGAGGGTGGATGCGGCCAAGGCTGAGGCGTTTGGGAC
TGCGGTGGCGTCTGGATTGATATGTGGAGATGGGATTTGGTCGTTTCCGAGCTCGGTGTTGGCTATAGCTGGTGTGAATC
CTCCTGTTTGTATGAAGTTTCTCTCTGCTGCGACTAATTCGAGAGTCGATAGCTTTCTGAAAAGATCAATGAACGGGAAG
GCCTCTGTTTCCAAGGAGCTCAACGCCAAACATTCAAAGATATTGGAAGCACTTTTAAAGCAACCAGACAATAGAGAATG
TGCAGATTGTAGATCAAAGGCACCGAGATGGGCAAGTGTGAACCTTGGGATATTCATATGTATGCAATGCTCCGGTATCC
ATCGCAGCCTTGGTGTTCACATCTCTCAGGTAAGGTCTATAACTCTGGATACATGGCTTCCAGATCAGGTTTCTTTCATG
CAATCTACTGGTAATGCTAAGGCAAATCAATACTGGGAATCAGAGTTGCCTCTTCATTTTGAGAGAAGTTCAAGCGACTC
GTTTATAAGAGCCAAATACAATGAGAAGAAGTGGGTTTCACCGGGAGGGATTCAACCTTCTCCTATAGCTAGCCAGCTAA
GCTGCAAAGTTAGTCACTTGGTAGAGAGCGGTTATAAGCCTGCAACTCCAAAGAAAGCAAGAACTCTTTCCCTTGATGAA
GACCTCCTTCTTAAGCATGTTCTTCAAGTTACACCTCCAGAAACAAGAATTCGAGCGGGTTCGGTAGATATGAAGGAGAA
TGTATATGCTCTACCTCTACCAGTGGGGATGGAAGCTAAGAAACCAAATCAAAAGAATGAGATTTTCTCCGGGGAAATGT
ATCAGAATAGAAGTACCACCATAGCACCACCCTCCAGCTGGGCTACTTTCGACTGTAAGGCGAACTTTTCTTTTTTTTAT
CTTATATATGAAATAAGCACACAGATGGCGGCGAGCGCGTGTCTCCGGCTGCCGGCGGCGATGGCTGTCCGGCGAGAGGA
AGGCGCTCCGAATTCAAAATCTTCGCAGGAAAAACCGAGAATTTATCTCAACAAACCTTCATGGATAGTCACAACTCAGT
GTGGCGCTAAGACGAGTAGAAAGGAGAAGGGTCGATGCGTAATCTGCCATGGAACTGGAAGAGTCGACTGTTTCAATTGT
AGCGGGAAAGGGAGGACTAACTGCGTGGATATGGAGATGCTTCCAAGAGGAGAGTGGCCCAAATGGTGCAGGAGCTGTGG
AGGGAGTGGTTTATGTGAATGCTCTCGCTGTCTTGGCACCGGAGAGTACAGATACATTATGGGTTTCCGCTTCTTGAACA
AACACGATGACGTGGATCCACAGTTATGA