Details for Kale Locus Bo1g119330

Position : C1 ( 5`- 35967711 .. 35968141 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo1g119330

Protein [Map View]
MTMLHPQRWLSSLIMFLLSSFMLKSDGSNHIVGDSSGWELYTNYTNWTQGREFHVGDVLVFNYNRDQHNVMQVNSTAYVD
CGRDNYISLFNKGNDSIVISVGSI*

DNA
ATGACAATGCTTCATCCGCAAAGATGGCTCTCCAGCTTGATCATGTTCTTGCTGTCGTCATTCATGCTAAAATCCGATGG
ATCAAACCATATAGTTGGCGACAGCTCTGGTTGGGAACTTTACACAAACTATACCAACTGGACACAGGGAAGAGAGTTTC
ATGTCGGCGATGTCTTAGTTTTCAACTACAATAGAGACCAGCATAATGTTATGCAAGTTAATTCTACAGCCTACGTAGAT
TGTGGAAGAGACAATTACATATCTCTCTTCAACAAAGGCAATGACTCAATAGTTATATCTGTTGGATCCATTTAA