Details for Kale Locus Bo1g119310

Position : C1 ( 5`- 35942625 .. 35945970 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo1g119310

Protein [Map View]
MASPKENDDVPMLPISDTSRTRPFTSRSRSVSLSNTCSTIDGFDSSTVVLGYTGPLRAQRRPPLVQMSGPLSSTRNPEPL
FLLPPPDSVGISSSQPERYPSFATLEHKKSDDEFVLKHANLLRSGQLGMCNDPYCTTCPSYYNRKAAQIPSSRVSAFFDS
KFHNALYDDAKGWARRFATTANRYLPGIMNPHSKFVQSWTKFFALSCLLAIFIDPLFFFLIFVKQNDKCIMIDWPMAKAF
VAVRSVTDILFSVNILLQFRLAYVAPESTVVGAGQLVAHPRKIARHYFRGKFLLDLFIVMPLPQILILWIIPAHLGASGA
NYAKNLLRAAVLFQYIPKLYRLLPLLAGQTPTGFIFESAWANFVINLLTFMLAGHVVGSCWYLFGLQRVNQCLRDACGNS
DHECRNLIDCGRGDSSEAFAAWKGNASASACFQDGGFPYGIYMKAVNLTSHTSLFTRYSYSLFWGFQQISTLAGNQVPSY
FLGEVFFTMGIIGLGLLLFALLIGNMQNFLQALGRRNLEMTLRRRDVEQWMSHRRLPEGIRKRVREAERFNWAATRGVNE
ELLFENMPDDLQRDIRRHLFIFLKKVRIFSLMDESILDAIRERLKQRTYISSSTVLHRGGLVEKMVFIVRGEMESIGEDG
SVLPLSEGDVCGEELLTWCLERSSVNPDGTRIRIPSKGLLSYRNVRCVTNVEAFSLSVADLEDVTSLFSRFLRNPRVQGA
IRYESPYWRLRAARQIQVAWRYRRRRLQRLYTAQSSYSL*

DNA
ATGGCTTCCCCCAAGGAGAACGATGATGTTCCCATGCTTCCAATCTCGGACACATCTCGTACTAGGCCTTTCACTTCCAG
GTCTCGTAGCGTTTCCCTCTCAAACACTTGTTCCACCATTGACGGTTTCGACAGCTCCACTGTGGTTTTAGGCTACACGG
GTCCTCTTCGAGCCCAGAGACGACCTCCTTTAGTTCAAATGAGTGGTCCTCTTTCCTCTACTCGCAATCCTGAGCCTCTC
TTTCTTCTTCCCCCTCCTGATTCAGTTGGTATCTCCTCGTCACAGCCTGAGAGGTATCCTTCTTTTGCTACTCTGGAACA
TAAAAAGTCAGACGACGAGTTCGTCTTAAAACACGCAAATCTCTTGAGATCTGGACAGTTAGGTATGTGTAATGATCCTT
ACTGTACCACTTGTCCTTCTTATTACAACCGTAAAGCTGCCCAAATCCCCAGTTCCAGAGTTTCTGCCTTCTTTGACTCC
AAGTTCCATAATGCTCTGTATGATGATGCTAAAGGCTGGGCTAGGCGGTTTGCTACAACTGCTAATAGATACTTACCAGG
AATCATGAATCCTCACTCTAAATTCGTTCAGAGCTGGACTAAGTTCTTTGCCCTCTCATGCTTGTTGGCTATTTTCATAG
ATCCTCTCTTCTTCTTTCTCATATTCGTCAAACAGAACGACAAATGCATTATGATTGATTGGCCGATGGCTAAAGCATTT
GTAGCTGTTAGAAGTGTAACAGATATTTTATTCTCTGTAAACATTCTGCTTCAGTTCCGATTGGCCTATGTAGCTCCCGA
GTCTACAGTTGTTGGTGCTGGCCAGTTAGTTGCTCATCCAAGAAAAATTGCTCGGCATTACTTCCGAGGAAAGTTTTTAC
TAGACTTGTTCATAGTAATGCCACTTCCACAGATATTGATATTATGGATAATACCAGCACATTTAGGTGCATCTGGGGCA
AACTACGCAAAGAACTTGTTACGCGCTGCAGTTCTTTTCCAGTACATTCCGAAGTTGTATAGACTACTACCACTTCTTGC
TGGCCAAACACCTACAGGCTTCATATTTGAGTCTGCTTGGGCTAATTTTGTTATTAATCTTCTCACCTTTATGCTTGCTG
GTCATGTTGTTGGCTCTTGCTGGTATCTTTTTGGTCTGCAGAGAGTTAACCAATGCCTACGAGATGCTTGCGGTAACTCT
GATCATGAATGTAGAAATCTTATAGATTGTGGTCGTGGAGATAGCTCTGAAGCGTTTGCTGCATGGAAAGGTAATGCAAG
TGCAAGTGCTTGTTTTCAAGATGGTGGTTTTCCTTATGGAATCTATATGAAGGCAGTCAATCTCACCAGTCATACTAGCC
TCTTCACAAGATATAGTTACTCTCTTTTCTGGGGTTTTCAGCAAATCAGCACGCTTGCTGGAAACCAAGTCCCAAGTTAC
TTTCTTGGGGAGGTCTTCTTTACCATGGGGATTATCGGTCTGGGGCTATTGCTTTTTGCGCTTCTTATTGGTAATATGCA
GAACTTCCTTCAAGCTCTTGGTCGAAGGAATCTTGAAATGACGCTGAGACGGCGTGATGTGGAGCAATGGATGAGCCATA
GGAGGTTGCCAGAAGGTATAAGAAAGAGGGTGCGAGAGGCTGAGCGGTTCAACTGGGCTGCTACTAGAGGAGTTAACGAA
GAATTGCTATTTGAGAATATGCCTGATGACCTTCAAAGAGATATAAGACGACACCTCTTCATTTTTCTCAAGAAGGTGAG
GATATTTTCTTTGATGGATGAATCAATCTTAGATGCCATCCGTGAGAGGCTGAAACAGAGGACATACATAAGTAGTAGCA
CGGTCTTGCACCGTGGAGGTCTAGTTGAGAAAATGGTATTTATAGTGAGAGGTGAGATGGAGAGCATTGGTGAAGACGGT
TCTGTTCTTCCTTTATCAGAAGGAGACGTTTGTGGTGAGGAGCTCCTCACTTGGTGCCTTGAACGATCTTCTGTTAATCC
TGATGGGACGAGGATAAGAATTCCATCAAAGGGATTGCTAAGCTACAGAAATGTTAGGTGTGTGACAAACGTGGAGGCGT
TTTCCCTGAGTGTAGCAGATCTTGAAGACGTAACAAGCTTGTTCTCGAGGTTCTTAAGGAATCCTAGAGTGCAAGGAGCC
ATTAGGTATGAATCTCCATATTGGAGGCTACGAGCAGCTAGGCAGATTCAAGTGGCATGGAGATACCGAAGGAGACGGCT
TCAGAGATTGTACACTGCTCAGTCTAGTTACAGCCTTTAG