Details for Arabidopsis Locus AT5G05390

Position : Chr5 ( 5`- 1594753 .. 1597042 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT5G05390

Protein [Map View]
MTTVHTFSILLFFCSLFSASLIIAKVQHHDFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNNGDTLEVKVHNRARYNIT
IHWHGVRQIRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPTPGSSFPFPKPDRQT
ALMLGEWWNANPVDVINQATRTGAAPNISDAYTINGQPGDLYNCSTKETVVVPINSGETSLLRVINAALNQPLFFTVANH
KLTVVGADASYLKPFTTKVLMLGPGQTTDVLLTADQPPKRYYIAARAYQSAQNAPFDNTTTTAILQYKKTTTTSKPIMPV
LPAFNDTNTVTSFSRKFKSLRNVVVPKTIDDNLFFTIGLGLDNCPKKFPKSRCQGLNGTRFTASMNNVSFVLPSNFSLLQ
AHSNGIPGVFTTDFPSKPPVKFDYTGNNISRALFQPVKGTKLYKLKYGSRVQVVLQDTNIVTSENHPIHLHGYDFYIVGE
GFGNFNPKKDTSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMAFLVDNGVGELETLEAPPH
DLPIC*

DNA
ATGACGACTGTTCACACATTCTCTATATTATTGTTCTTTTGTTCCCTTTTCTCGGCTTCATTGATTATCGCCAAAGTCCA
ACACCATGATTTTGTCATACAAGAGACGCCGGTGAAGAGGCTGTGCAAGACCCGTAACGCCATCACCGTCAACGGAATGT
TTCCGGGGCCTACGCTCGAAGTCAACAACGGCGACACTCTTGAAGTCAAAGTGCATAACCGTGCTCGTTACAATATCACC
ATCCATTGGCATGGAGTGAGGCAGATAAGAACCGGATGGGCTGATGGCCCAGAATTCGTGACCCAATGCCCGATCCGACC
CGGAAAGAGCTACACGTACCGTTTCACTATCCAAGGCCAAGAAGGGACATTGTGGTGGCACGCTCACAGCTCTTGGCTCC
GAGCCACTGTCTACGGCGCACTCATCATTCACCCAACCCCTGGTTCCTCTTTTCCTTTCCCTAAACCGGACCGCCAAACC
GCCCTCATGCTCGGGGAATGGTGGAATGCAAATCCGGTTGATGTAATTAACCAAGCGACTCGAACCGGAGCTGCTCCTAA
TATATCCGACGCTTATACCATCAATGGTCAACCGGGTGATCTCTATAATTGCTCGACCAAAGAGACTGTTGTAGTACCGA
TAAATTCAGGGGAAACAAGTCTCCTACGAGTGATCAACGCAGCTTTAAACCAACCGCTATTTTTCACTGTGGCTAACCAC
AAGCTCACTGTAGTTGGAGCCGACGCATCTTACCTCAAACCATTCACCACAAAGGTCCTTATGTTAGGTCCAGGCCAAAC
TACTGACGTACTTCTAACCGCAGACCAACCCCCAAAACGCTATTACATAGCAGCAAGAGCTTACCAAAGCGCTCAAAACG
CACCGTTTGATAACACCACAACTACAGCCATTCTCCAATACAAGAAGACGACGACCACTTCTAAACCAATCATGCCGGTT
TTGCCTGCCTTCAACGACACGAACACCGTGACGTCTTTCTCAAGGAAGTTCAAATCTCTCCGTAACGTCGTCGTACCGAA
AACAATCGATGATAATTTGTTCTTCACCATTGGTTTAGGTCTTGATAATTGTCCCAAAAAATTCCCTAAAAGCCGGTGCC
AAGGCTTGAACGGAACCCGGTTTACCGCATCGATGAACAACGTTTCGTTTGTTCTACCGTCGAATTTCTCGCTCTTACAA
GCACATTCCAACGGAATTCCCGGCGTTTTCACAACGGATTTTCCGTCTAAACCGCCGGTTAAATTCGATTATACCGGAAA
TAACATAAGCAGGGCTCTGTTTCAGCCGGTTAAGGGTACTAAACTGTATAAACTAAAGTATGGATCTCGAGTTCAAGTTG
TTTTACAGGATACAAACATTGTTACATCGGAGAATCACCCGATTCATCTTCACGGTTACGATTTCTACATTGTTGGTGAA
GGGTTCGGTAACTTTAATCCCAAGAAAGATACTTCTAAGTTTAATCTTGTTGATCCTCCGCTTAGAAACACTGTGGCTGT
TCCTGTTAATGGATGGGCTGTTATCAGATTCGTGGCAGATAATCCAGGGGTTTGGTTGATGCATTGTCACTTAGATGTTC
ATATAAAGTGGGGTCTTGCTATGGCGTTCTTGGTCGACAATGGTGTCGGAGAATTGGAGACTCTTGAAGCTCCTCCTCAC
GATCTACCTATTTGCTAG