Details for Arabidopsis Locus AT5G05380

Position : Chr5 ( 5`- 1592130 .. 1593026 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT5G05380

Protein [Map View]
MMANPPTLPISDHSGGGSQSQQPVSTPAFRTFLSRLSSSIRQSLSQRRPWLELVDRSAISRPESLTDAYSRIRRNLPYFK
VNYVTIVSLVLALSLLSHPFSLLVLLCLFCAWIFLYLFRPSDQPLVVLGRTFSDRETLGVLVILTIVVVFLTSVGSLLTS
ALMIGFGIVCLHGAFRVPEDLFLDDQEPANTGLLSFLSGAATSAAVAAASTPASGRV*

DNA
ATGATGGCTAATCCTCCAACGTTACCGATCTCAGACCATTCCGGTGGTGGTTCCCAATCTCAGCAACCCGTATCAACACC
GGCGTTTCGCACGTTCCTCTCTCGCCTCTCGTCGTCAATCCGCCAAAGCCTATCGCAGCGGCGTCCATGGTTAGAACTCG
TAGATCGAAGCGCAATTTCACGTCCAGAGTCTCTCACCGATGCGTATTCTCGGATCCGGAGGAATCTCCCTTACTTCAAG
GTAAACTACGTGACGATCGTCTCCTTGGTGCTCGCGCTCTCGCTCCTCTCCCATCCTTTCTCTCTTCTCGTTCTCCTATG
CCTCTTCTGCGCTTGGATCTTCCTCTACCTTTTCCGTCCGTCAGATCAACCTCTGGTCGTCCTCGGCCGTACGTTTTCAG
ATCGTGAGACGCTTGGTGTTTTGGTAATTTTGACAATCGTCGTCGTCTTTTTAACCAGCGTTGGGTCTTTATTGACCTCT
GCTTTGATGATTGGTTTCGGAATCGTATGCTTACACGGCGCGTTTAGAGTCCCGGAGGATCTTTTCTTGGATGATCAAGA
ACCTGCTAACACCGGCTTATTGTCTTTCCTTAGCGGAGCCGCCACTTCCGCCGCAGTTGCCGCCGCATCAACTCCTGCGT
CAGGTCGTGTTTGA