Details for Arabidopsis Locus AT5G05290

Position : Chr5 ( 5`- 1568694 .. 1569864 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT5G05290

Protein [Map View]
MNLTEYSHILFLSLCTLNFCLYSINSDDNGGWERGHATFYGGADASGTMGGACGYGNLHSQGYGLQTAALSTALFNSGQK
CGACFELQCEDDPEWCIPGSIIVSATNFCPPNFALANDNGGWCNPPLKHFDLAEPAFLQIAQYRAGIVPVAFRRVPCEKG
GGIRFTINGNPYFDLVLITNVGGAGDIRAVSLKGSKTDQWQSMSRNWGQNWQSNTYLRGQSLSFQVTDSDGRTVVSYDVV
PHDWQFGQTFEGGQF*

DNA
ATGAATCTTACAGAATATTCCCATATTTTGTTTCTTTCACTATGCACCCTCAACTTCTGCTTGTACTCCATAAACTCCGA
CGACAACGGAGGCTGGGAGAGAGGCCATGCTACCTTCTATGGTGGAGCTGATGCATCCGGCACAATGGGTGGTGCTTGTG
GGTACGGTAACTTACACAGCCAAGGCTATGGGCTACAAACCGCGGCTTTGAGCACGGCTTTGTTCAATAGTGGGCAGAAA
TGTGGGGCCTGCTTTGAGCTACAGTGTGAGGATGATCCTGAGTGGTGCATCCCTGGTTCCATCATCGTCTCGGCTACAAA
CTTCTGTCCTCCAAACTTTGCCTTAGCTAATGATAATGGTGGTTGGTGCAATCCTCCTCTTAAGCACTTTGACTTGGCCG
AGCCTGCCTTCCTCCAGATCGCTCAGTACCGAGCTGGGATCGTTCCTGTCGCATTCAGAAGGGTTCCATGTGAGAAAGGT
GGAGGGATAAGGTTTACGATAAACGGGAATCCATATTTCGACCTCGTGCTAATCACGAATGTGGGTGGTGCTGGAGATAT
AAGGGCCGTCTCTTTGAAAGGCTCAAAGACAGATCAGTGGCAATCCATGTCAAGAAACTGGGGACAGAATTGGCAAAGCA
ACACTTACCTCAGAGGTCAAAGCCTTTCTTTCCAAGTCACTGATAGTGATGGTCGGACTGTTGTGAGCTACGATGTTGTG
CCTCATGATTGGCAGTTCGGTCAGACTTTTGAAGGCGGACAATTTTAG