Details for Arabidopsis Locus AT5G05240

Position : Chr5 ( 5`- 1553814 .. 1556556 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT5G05240

Protein [Map View]
MEEHDAVSGGCSPIPRSDLKIGGNELDERQELSKIEPVTPTLNSGNTVHGSKDVEKANGMSQVGKVSESFVTEGKNIKTE
LLVGQEVKSSSSKLVLNTDVDCDKRALLKRCDNADAVSSCLNDDLTSVCSSRISQKTSSMDVYSECGSSNGSVAKRDPMK
VWTEMKQNGYLSNPNGGISTTSSSCLISSSHGGIPAPKKRGRKTKINNDAAVAKKRKIERKEEVDRFARLAAPSGLLNEL
NPGIINHVRNKKQVLSIIENIVKSERDAGNYHSTLRHSNSADGSPRKNLGDACRSEFYQVFQYALPKDMYSMRYYAEKCA
DDEFSEENNTVRSRFQVAGKFSENDSSLSSEDASDLNSASVLTVNAATVASQWLELLHQDIKGRVSALRRSRKRVRAVVT
IELPHLIRKEFPADQENDPTLLLGGASKASTVDIHKSRWMTLFKQLEHKLSEEESQLESWLNQVRYMQSHCDEGLQHLSL
SSGQNFLQLGMPLDSRAANALISDKDLVIKAAAASIYSTCSFLEENITCS*

DNA
ATGGAAGAACACGACGCTGTTTCTGGAGGGTGTTCTCCGATTCCCAGATCCGACTTAAAGATCGGCGGCAATGAATTGGA
TGAAAGACAGGAGTTGAGTAAAATTGAACCTGTTACACCAACTCTAAATTCAGGTAACACTGTTCATGGTTCTAAAGACG
TTGAAAAAGCCAATGGCATGTCTCAAGTTGGTAAAGTTTCAGAGAGTTTTGTTACAGAAGGGAAGAATATTAAGACTGAA
CTGTTGGTGGGTCAAGAGGTTAAGTCTTCTTCCAGTAAGCTTGTTCTCAACACTGATGTTGATTGTGATAAGCGAGCTTT
GCTTAAGAGATGTGATAATGCGGATGCTGTTTCCAGCTGCTTGAATGATGATTTAACTTCGGTTTGCTCCTCTAGGATAA
GCCAGAAAACTAGTTCAATGGATGTTTATTCAGAGTGTGGGAGTTCCAATGGTTCTGTAGCCAAAAGAGATCCAATGAAG
GTTTGGACAGAGATGAAACAGAACGGGTATCTCTCTAATCCGAATGGTGGGATTTCAACGACATCAAGTAGCTGTCTCAT
ATCATCTTCTCATGGAGGGATACCGGCTCCAAAGAAACGTGGACGCAAAACCAAGATTAATAATGACGCTGCAGTGGCGA
AGAAGAGAAAGATAGAAAGGAAGGAAGAAGTTGACAGGTTTGCTAGGCTTGCTGCTCCTAGCGGACTGCTTAACGAATTG
AACCCTGGAATTATTAACCATGTGAGAAACAAAAAGCAAGTACTTTCCATTATCGAAAACATTGTCAAGTCTGAAAGAGA
TGCTGGAAACTATCATTCTACATTGAGGCATAGTAATAGTGCAGATGGGAGTCCTAGGAAAAACTTGGGAGATGCCTGCA
GATCTGAATTTTACCAAGTATTCCAGTATGCCTTGCCTAAAGATATGTACTCTATGCGCTACTACGCCGAGAAATGCGCT
GATGATGAGTTCAGTGAAGAAAACAATACAGTTAGGTCGAGGTTTCAGGTGGCAGGTAAGTTCTCAGAAAATGACAGTTC
CTTGTCGAGTGAGGACGCATCAGATCTTAACAGTGCTAGTGTTCTCACTGTTAATGCGGCTACAGTAGCTTCTCAATGGT
TGGAATTGCTTCATCAGGACATCAAAGGCCGTGTTTCTGCTCTTCGACGTAGCAGGAAGAGGGTTCGTGCAGTTGTCACG
ATAGAGTTACCTCACTTAATAAGGAAAGAGTTTCCAGCTGATCAAGAAAATGACCCAACTCTACTCCTTGGTGGGGCTTC
GAAGGCTTCAACAGTCGATATCCATAAGAGCAGATGGATGACTCTGTTTAAGCAACTCGAACACAAGCTATCAGAAGAAG
AGTCACAATTGGAAAGCTGGTTAAACCAAGTGAGATATATGCAATCACATTGTGATGAAGGTCTGCAACACTTGAGCTTG
AGTTCTGGTCAGAATTTCTTACAGTTAGGGATGCCATTGGACTCTAGAGCTGCAAACGCGCTGATCTCAGATAAGGATTT
AGTCATTAAAGCAGCTGCAGCCTCTATATACTCGACCTGCAGTTTTCTAGAGGAGAACATAACCTGTAGCTGA