Details for Arabidopsis Locus AT5G05150

Position : Chr5 ( 5`- 1524841 .. 1526199 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT5G05150

Protein [Map View]
MNSIVSTVRGILTLSRSETFDSPRDEAKSDLKVLSVAWNQVCSGFIVGTNHGFNVYSCKPMIKKSISRAPHESGFKVAEM
LFLSNLFAFVGNGYNNSEYPPNKVFVWDDYRNCCLSELTFKSEVIAVKLAREHVVVVLKQNIYVYTFNNLKVDRVIETLM
NPKGLCCVTHVESKAVLACPGFHPGQVQVHDLRWNVIKFIKAHDSAIACMTLTLDGSLLATASTKGTLIRIFNAVDGTLL
QEFRRGVERAEIYNVAISSNLKWVAASSEKGTLHVFRLRPDILSFDPASSSSFIRVILPKYLYENERSFAQFSLPASTKF
IVGFGSENTVLLVGIDGSFRRCKFDHADGGQMVELEHKYFFSLQETGNTMVGGV*

DNA
ATGAATTCGATTGTCTCCACTGTCCGTGGAATCTTAACGCTTTCAAGATCTGAAACTTTCGATTCACCACGTGATGAAGC
AAAAAGTGACTTGAAGGTGTTATCAGTAGCTTGGAACCAGGTATGCAGTGGTTTCATCGTTGGAACAAATCACGGTTTCA
ATGTATATAGCTGCAAACCAATGATAAAGAAAAGCATCAGCCGTGCCCCGCACGAATCAGGCTTCAAAGTTGCTGAGATG
CTCTTCCTTTCTAACTTATTCGCTTTTGTTGGCAATGGTTATAACAATTCCGAGTACCCTCCTAACAAAGTATTCGTTTG
GGATGATTACCGAAATTGCTGCCTCAGCGAGCTCACTTTTAAATCAGAAGTTATCGCTGTGAAACTAGCGAGAGAACACG
TTGTGGTGGTCCTGAAACAAAACATCTATGTCTACACTTTCAACAACCTTAAGGTTGACCGTGTGATCGAAACCCTCATG
AACCCGAAAGGACTGTGTTGCGTCACTCACGTTGAGTCGAAAGCAGTCTTGGCTTGTCCCGGGTTTCATCCGGGACAAGT
TCAGGTCCATGACTTGAGATGGAATGTTATCAAATTCATCAAAGCACATGATTCTGCTATAGCTTGCATGACTTTGACTC
TCGATGGAAGTCTCCTCGCAACCGCTAGCACCAAAGGAACTTTGATCAGGATCTTTAACGCCGTTGATGGTACTCTCTTA
CAAGAGTTTCGGAGAGGAGTGGAAAGAGCAGAGATCTATAACGTTGCAATCTCTTCGAATCTGAAATGGGTCGCTGCGTC
AAGTGAAAAAGGGACTCTCCATGTATTTCGTTTGAGACCTGACATTCTTAGTTTTGATCCGGCTTCATCGTCGTCATTCA
TAAGAGTGATCTTACCAAAGTATTTGTACGAAAATGAACGGTCGTTTGCTCAGTTCTCGTTGCCAGCTTCCACCAAGTTC
ATTGTAGGTTTTGGATCAGAGAACACTGTTCTTCTCGTAGGCATCGATGGAAGTTTCCGGAGGTGCAAATTTGATCATGC
AGATGGAGGGCAGATGGTGGAATTGGAACACAAATACTTCTTCTCCTTACAAGAGACGGGCAACACAATGGTTGGTGGGG
TGTGA