Details for Arabidopsis Locus AT3G66658

Position : Chr3 ( 5`- 2095105 .. 2099151 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G66658

Protein [Map View]
MPFWWPLIVLAFAYAICKFLLMLIPPNVPSIDVDASDVLAHGKDTEENSFIYIPPRGRSQQSDKKVQCYEPATMKYLGYF
PALSPTEVEERVTLSRKAQKTWAQSSFKLRRQFLRILLKYIIEHQELICEVSSRDTGKTMVDASLGEIMTTCEKITWLLS
EGERWLKPESRSSGRAMLHKVSRVEFHPLGVIGAIVPWNYPFHNIFNPMLAAVFSGNGIVIKVSEHASWSGCFYFRIIQA
ALAAVGAPENLVDVITGFAETGEALVSSVDKMIFVGSTAVGKMIMRNAAETLTPVTLELGGKDAFIICEDADVSHVAQVA
VRGTLQSSGQNCAGAERFYVHKDIYTAFIGQVTKIVKSVSAGPPLTGRYDMGAICLQEHSEHLQSLVNDALDKGAEIAVR
GSFGHLGEDAVDQYFPPTVLINVNHNMKIMKEEAFGPIMPIMQFSTDEEVIKLANDSRYALGCAVFSGSKHRAKQIASQI
QCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGIEGLRACCLVKSVVEDRFWPLIKTKIPKPIQYPVAENAFEFQEALV
ETLYGLNIWDRLRSLIDVLKFLTDQSSNVSRTRKSH*

DNA
ATGCCGTTTTGGTGGCCACTGATCGTCCTCGCCTTCGCTTACGCGATCTGCAAGTTCCTTCTTATGCTCATTCCTCCCAA
TGTTCCTTCCATTGACGTTGACGCATCCGATGTGTTGGCTCATGGGAAAGATACGGAGGAGAATAGCTTCATCTATATTC
CTCCCAGAGGAAGGAGCCAACAGTCTGACAAAAAAGTTCAATGTTATGAACCTGCCACAATGAAATATCTGGGATATTTC
CCTGCTCTGTCGCCTACTGAGGTCGAGGAGCGCGTAACACTATCAAGGAAGGCTCAAAAGACATGGGCTCAAAGTAGCTT
CAAGCTTAGAAGGCAGTTCTTGCGGATTCTTCTTAAGTACATTATTGAACACCAAGAGCTTATATGCGAAGTCTCTTCAC
GTGATACTGGAAAGACTATGGTAGATGCGTCCCTGGGAGAAATTATGACTACTTGTGAGAAAATTACTTGGCTTCTTTCT
GAGGGCGAACGATGGTTAAAGCCTGAATCTCGTTCTTCAGGAAGAGCTATGCTTCATAAAGTATCACGAGTAGAGTTCCA
TCCCCTTGGTGTCATTGGAGCTATAGTCCCATGGAATTATCCCTTCCACAATATTTTCAACCCTATGCTGGCTGCAGTCT
TCTCTGGGAATGGCATTGTTATTAAGGTTTCAGAACACGCTAGCTGGTCGGGATGCTTTTACTTCCGCATAATCCAGGCA
GCTTTAGCTGCTGTTGGAGCACCAGAAAATCTAGTCGATGTGATAACAGGGTTTGCGGAGACCGGAGAAGCACTTGTCTC
ATCTGTTGATAAAATGATATTTGTTGGATCCACAGCTGTTGGCAAGATGATAATGAGAAATGCTGCCGAGACATTGACAC
CTGTCACTCTTGAGCTTGGTGGAAAAGATGCATTTATCATATGTGAAGACGCAGATGTCTCACATGTTGCACAAGTGGCT
GTAAGGGGCACTCTTCAGTCCAGCGGGCAAAACTGTGCCGGTGCTGAAAGATTTTATGTCCACAAAGACATTTATACTGC
ATTCATTGGCCAAGTAACCAAGATTGTGAAGTCAGTTTCTGCTGGTCCTCCTCTAACTGGAAGGTATGACATGGGAGCTA
TATGTTTGCAAGAGCACTCTGAACACCTACAGAGCCTTGTAAATGACGCCTTAGACAAAGGAGCTGAAATTGCAGTCCGT
GGCAGCTTTGGTCATCTGGGGGAAGATGCAGTCGATCAATATTTCCCTCCAACTGTTCTCATCAATGTGAACCACAACAT
GAAAATAATGAAAGAAGAGGCTTTTGGACCAATAATGCCAATCATGCAATTCAGCACCGATGAAGAGGTCATAAAGCTGG
CAAATGATTCACGTTATGCTCTAGGCTGTGCTGTTTTCTCTGGAAGCAAGCATCGCGCCAAACAAATAGCTTCTCAAATT
CAGTGCGGTGTTGCTGCAATCAATGACTTTGCATCAAATTACATGTGCCAGTCGCTCCCGTTTGGAGGTGTAAAGGATAG
TGGGTTTGGACGGTTTGCTGGAATAGAAGGTTTAAGAGCATGCTGTCTTGTGAAATCGGTGGTTGAAGATAGATTTTGGC
CACTCATCAAGACCAAGATTCCAAAACCTATTCAGTATCCGGTAGCAGAAAACGCATTTGAATTCCAGGAGGCCCTAGTC
GAAACTCTTTATGGACTCAACATTTGGGACCGGCTAAGATCCCTAATCGATGTCCTCAAGTTCCTTACCGATCAGAGCTC
TAACGTGAGCAGAACTAGAAAGAGCCACTGA