Details for Arabidopsis Locus AT3G66656

Position : Chr3 ( 5`- 2091262 .. 2091798 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G66656

Protein [Map View]
MGRRKIKMEKVQDTNTKQVTFSKRRLGLFKKASELATLCNAEVGIVVFSPGNKPYSFGKPNFDVIAERFKNEFEEEEEGD
SCETSGYSRGNRARQEKKICKRLNSITEEAEAEKKHGEDLHKWLESAEQDKFNKPIEELTLEELKEFEAKIKKISCGIQS
NISHMQASSSLMFLSNDN*

DNA
ATGGGTAGGAGAAAGATTAAGATGGAGAAAGTGCAAGACACAAACACGAAGCAAGTTACCTTCTCAAAACGTAGGCTGGG
TTTGTTCAAGAAAGCGAGCGAGCTTGCGACTCTGTGCAACGCGGAGGTTGGTATTGTTGTCTTTTCTCCAGGAAACAAAC
CGTATTCCTTCGGGAAACCGAATTTTGATGTGATTGCAGAACGGTTTAAGAATGAATTCGAAGAAGAAGAAGAAGGAGAT
AGCTGTGAAACATCAGGCTATAGTAGAGGCAATAGAGCTAGACAGGAGAAGAAGATATGTAAACGCCTCAACTCGATTAC
TGAAGAAGCTGAAGCTGAGAAGAAACATGGTGAAGATCTTCACAAGTGGCTTGAATCTGCTGAACAGGATAAGTTCAATA
AGCCCATTGAGGAGCTTACGCTTGAGGAACTCAAGGAATTTGAGGCTAAGATTAAGAAAATAAGCTGTGGGATCCAAAGT
AACATTAGTCATATGCAGGCTTCGTCTTCTCTCATGTTTCTCTCTAATGATAATTAG