Details for Arabidopsis Locus AT3G66654

Position : Chr3 ( 5`- 2087980 .. 2090495 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G66654

Protein [Map View]
MAKIKPQALLNQSKKKKGPSRISISTIIVCNLVVAVVILSLVTTYRHWSQRSRNTIEHETRSQRFEDTNTASGQKTYDLP
GFADINTSKGLITVELFKEGSPEVVDKFLDLCQKDHFKGMPFQRVIKNYLVQAGHSPSSIPVEEWTAKGKLRGRLHIGPK
HEAFMLGTPKNKGNNKDFELLITTAPIPDLNDQLIVFGRVLKGEDVVQEIEEVDTDEHFQPKSPIGITGVVLKLET*

DNA
ATGGCGAAGATAAAACCGCAGGCTCTTCTAAATCAAAGCAAGAAGAAGAAGGGTCCAAGTCGCATAAGTATTTCCACTAT
TATTGTCTGTAATCTTGTAGTTGCTGTAGTCATATTATCGTTGGTCACAACCTATCGCCATTGGTCCCAAAGGTCAAGAA
ACACAATTGAACATGAAACTCGGAGTCAGAGATTTGAGGACACTAATACTGCGTCAGGGCAAAAAACTTACGATCTTCCT
GGTTTTGCTGATATAAACACATCAAAAGGACTTATAACTGTCGAACTCTTCAAAGAAGGTTCCCCTGAAGTTGTGGACAA
GTTTCTAGATCTATGTCAAAAAGATCACTTCAAGGGAATGCCGTTTCAGCGGGTTATAAAGAACTACTTGGTACAAGCTG
GTCACTCACCGAGCTCTATACCTGTAGAAGAATGGACAGCTAAAGGAAAGCTCAGAGGTCGCCTTCACATTGGCCCAAAA
CATGAGGCATTCATGTTGGGAACACCAAAAAACAAAGGGAACAACAAGGATTTTGAGCTTCTGATCACAACGGCCCCAAT
CCCGGATCTGAATGATCAACTTATAGTGTTTGGAAGAGTCCTTAAGGGAGAGGATGTAGTACAGGAGATCGAAGAAGTGG
ATACGGATGAGCATTTCCAACCGAAATCGCCAATAGGGATCACTGGTGTTGTACTGAAACTAGAGACATGA