Details for Arabidopsis Locus AT3G66652

Position : Chr3 ( 5`- 2083394 .. 2087556 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G66652

Protein [Map View]
MDSTDDDFGDLYVDDAKFQATDAFESECATNSGEDKGFEETVKSDSEGEVKKFDVVAKDSSPCDDDDCAMNLTEADEESE
FSDSDDDLNIVLKDDDSKALPASCVFNTNFGGYEASKASSFQRRWTRNASANNACIDPSLGMSQYRYSFPNPWSRTPFDV
NLDVLEKKPWRDPGTDTSDFFNFGLNEQSWKDYCKPLGRAIEVRGGTLERIPSADLRRPRDPDPGVVIQIPVTNDVEELP
VRTPEKARCITSNEASRSDVSHSYGSKDLNSVYGSPKDEAFVGCQEENAGSFSGEKSLPTENCCSREATPSDKEMLEKEK
EESVCNSDETDPSSVERESSLGDRIRLSPTSSSSVGINEESDDYETESLKDSATDDQREVSTPPQEARLAEHEAISIKRG
EDSGTMHSRHRRSHEDSSKRHCGRAGYARYVKDASPTPDPGRGKKVGSLQGLYRDSNKNWQNGPPITLERDETEGKGVHY
YREKSHGRLNSSVDHDRHREHRFGWRNNKESSLGRGFDHSNSYKCGTHLKEYTSRSSFDLNQRNSRSSFKEEDDRYGWHH
RERKYVHERSPIRAYENYKERNGCDWLREPYYEDCIPITDMDYRYRSENSSAHAIHNLKHSPENDLYCRRRGGYDYNLHR
DRYEDGVHRVESRIPFELAYREMRSFAEVEMREYQGYKRHEEFSEIEKRHHYIHDWHLDRFVSEEDGYKYRIQDGWSSPS
LSLRDSWYTKEAKGDFRRDDTRDFRTPEAYDSQNNHFHKAAPRDGWTQNLGRSHNVSVKDRLQYDADWVGPDRGRYNMAD
DMQCSMREVSNSEHPSYTDEIFVRDIRVPTHNRMATKQRFGYLQSHIHENDERHHRSKKLRGDGHAFIKRQDHVDLAGRQ
GKVSNQSKKRFSNGGDTIEQQDVQKPRKLMGKSEEKAMQNRDINDKEEGEIIEEVKGVEIDNERIQESLKKMEKRRERFK
GTKLAVEATFKSQTELRAKADVTNQQRPVRKRRWCAS*

DNA
ATGGATTCTACTGATGATGATTTCGGTGACTTGTACGTTGATGATGCCAAGTTTCAGGCGACTGATGCTTTCGAATCGGA
GTGTGCTACGAACTCCGGCGAGGATAAGGGTTTTGAAGAGACGGTAAAGTCTGATTCGGAAGGTGAAGTGAAGAAATTTG
ATGTTGTTGCTAAGGATTCGAGTCCGTGTGACGACGACGATTGTGCTATGAATCTGACTGAGGCCGATGAAGAATCGGAA
TTTAGTGATAGTGATGATGATTTGAATATAGTGCTCAAAGACGACGACTCTAAAGCCCTTCCTGCTTCTTGTGTGTTTAA
CACCAACTTTGGCGGATACGAAGCATCCAAAGCTTCCTCGTTTCAGAGACGGTGGACTAGAAACGCTTCAGCTAATAATG
CTTGCATCGATCCTTCTTTAGGAATGTCTCAATACAGATATAGTTTCCCAAACCCTTGGTCCAGGACACCTTTTGATGTA
AATCTCGATGTGTTAGAGAAGAAGCCATGGAGGGATCCTGGTACGGATACCAGTGACTTTTTTAATTTTGGGCTTAACGA
GCAGAGCTGGAAAGATTACTGTAAACCGTTGGGAAGAGCAATTGAGGTTAGAGGTGGTACTCTTGAGCGAATACCTTCTG
CAGATTTGCGTCGTCCACGTGATCCTGACCCTGGCGTGGTGATACAGATCCCAGTTACTAATGATGTTGAGGAGCTACCA
GTCAGGACACCTGAGAAAGCAAGATGCATAACATCAAATGAAGCATCTAGAAGTGACGTTTCTCATTCATATGGTAGCAA
GGATTTGAATTCAGTCTATGGTTCTCCAAAAGATGAAGCTTTTGTGGGGTGTCAAGAAGAAAACGCTGGAAGTTTCAGTG
GCGAGAAATCTCTTCCAACAGAGAATTGCTGCAGTAGGGAAGCAACACCTAGTGATAAGGAAATGCTTGAGAAGGAGAAA
GAAGAGAGTGTTTGCAATTCTGATGAGACGGATCCATCCTCAGTGGAGAGGGAATCATCTCTTGGAGATCGCATTCGTTT
GAGCCCTACCTCTTCTTCTTCTGTTGGTATAAATGAGGAATCTGATGATTATGAAACAGAGTCATTGAAAGACAGTGCTA
CTGATGACCAACGTGAAGTCAGTACCCCACCACAAGAAGCTAGACTTGCAGAACATGAAGCAATTAGTATCAAAAGAGGG
GAAGATAGTGGTACAATGCATTCTAGACACAGAAGATCTCACGAAGACTCCAGCAAAAGGCACTGTGGGAGAGCTGGTTA
TGCTCGCTATGTTAAGGATGCATCGCCTACACCAGATCCTGGTCGTGGGAAGAAAGTTGGTTCTCTACAGGGCTTGTATC
GTGATTCAAACAAAAACTGGCAGAATGGACCACCTATTACATTAGAGAGGGATGAAACTGAAGGTAAAGGCGTTCATTAC
TATAGAGAAAAATCTCATGGTAGATTGAATTCATCTGTGGATCATGATAGGCATAGAGAGCACAGGTTTGGTTGGCGGAA
CAACAAAGAATCATCACTCGGTCGAGGTTTTGATCATTCTAATAGTTACAAGTGTGGGACGCATCTTAAAGAGTATACCT
CACGTTCATCCTTCGATCTTAATCAGAGAAATTCTAGATCAAGTTTTAAAGAAGAGGATGATCGATATGGTTGGCATCAT
CGTGAAAGAAAATATGTTCATGAAAGAAGTCCTATCCGAGCATATGAAAACTACAAAGAAAGAAATGGGTGTGATTGGCT
AAGAGAACCTTATTATGAGGACTGTATACCGATTACTGACATGGATTATAGGTACCGGTCAGAGAACTCGTCTGCACATG
CAATACACAACCTCAAGCACAGTCCAGAGAATGATCTTTATTGCAGAAGAAGGGGTGGATACGATTATAATTTGCATCGT
GATAGATATGAAGATGGAGTTCACAGGGTAGAAAGTAGAATTCCATTTGAGCTGGCGTACAGGGAGATGCGTTCTTTTGC
TGAAGTGGAAATGAGAGAATATCAAGGGTATAAAAGACATGAGGAATTCTCTGAAATAGAGAAAAGACATCATTACATTC
ATGATTGGCATCTTGATAGATTTGTCTCAGAGGAAGATGGTTATAAGTATAGAATCCAAGATGGTTGGTCCTCACCGTCT
TTATCTTTGAGAGATTCTTGGTATACCAAAGAAGCAAAAGGTGATTTCCGGAGAGATGATACCAGAGACTTCAGAACACC
TGAAGCATATGACAGCCAGAATAACCATTTTCATAAGGCTGCACCGAGAGATGGCTGGACGCAGAATCTTGGTCGTAGCC
ATAATGTGAGCGTAAAAGATAGACTACAGTATGATGCTGATTGGGTTGGTCCTGATAGAGGAAGATATAATATGGCAGAT
GACATGCAATGTTCAATGAGAGAAGTTTCTAATTCTGAGCATCCATCATATACTGATGAGATATTTGTCCGCGACATAAG
AGTACCGACACATAATCGGATGGCGACCAAACAAAGGTTTGGATATTTACAGAGCCATATTCATGAAAATGATGAAAGAC
ATCACAGATCCAAGAAGCTGAGAGGAGATGGGCATGCTTTCATCAAGCGTCAGGATCATGTTGACTTAGCTGGTAGGCAA
GGAAAGGTCTCTAACCAATCAAAAAAAAGATTCTCCAATGGCGGAGATACAATCGAGCAACAAGATGTTCAGAAACCAAG
AAAGTTAATGGGCAAAAGCGAAGAGAAAGCTATGCAGAATCGAGATATAAATGACAAAGAAGAAGGCGAGATAATAGAAG
AAGTGAAAGGTGTTGAAATAGACAATGAACGTATACAAGAGAGTCTGAAAAAGATGGAGAAACGGAGGGAGAGGTTCAAG
GGAACCAAATTGGCGGTAGAAGCGACATTCAAATCTCAAACTGAACTGAGAGCTAAAGCCGATGTTACTAATCAACAGAG
GCCAGTTAGAAAGAGGAGATGGTGTGCAAGTTAA