Details for Arabidopsis Locus AT3G56660

Position : Chr3 ( 5`- 20986217 .. 20988213 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56660

Protein [Map View]
MAEPVLEDTYLTFSSDFDYIAIAPSPFDNFCNSNSDQVRNSISDLRFLIDDDDSFDDLYFPSENESFCIPPDATKREMSG
DFTPASGISGDCVNEDTEKNTNGVLISTSSCYNRESPTDSDFSGTSQSLSFSGQDSAKRKTEIEEDSSDESRRLGKDGFA
SVIKVGGEEDDEKKKNVRLVRNRESAHLSRQRKKHYVEELEDKVKNMHSTISELSSKMSYFVAENVTLRQQMGTRFSSGP
PMVPIVYPWMQYPAYMVKPQGSQVALLPIPRLKPKHSVAKVKKFKKVASFSVFGFLFCMFLFGALVNISYGEYKSNYVTD
GVYDQSRGRVLVVDSSRVHCGGDSDQGVGRNVSETENLGPPRNSSEPLVASLFVPRNEKLVKIDGNLIIHSVLASEKARD
SETKNEEGKSVLATTTKTLSPALPLPDSTSPRTRDVSKHLYSETGKGLSSSGSDDASNDQLKSTIANGKMQQWFREGVAG
PMFSSGMCTEVFQFDVSSNSGAIIPASPHTQQCKNTSDTQKGKKNRRILSGGLPVSDFNLTKEDHNSSSKDKFRETKPGP
SMVVSVLVDPREGGNGDIDGMMGGTKPQSRVFIVVLVDGVKYITYSCVLPRPDVPHLMTS*

DNA
ATGGCGGAACCAGTTTTGGAGGACACTTATCTTACTTTCTCTTCCGATTTCGATTACATCGCGATCGCTCCTTCTCCCTT
TGATAATTTCTGCAATTCTAACTCTGATCAAGTTCGGAACTCGATCTCTGATCTGAGGTTTTTGATTGACGACGACGACA
GTTTCGACGATCTCTACTTCCCTTCTGAGAACGAATCGTTCTGCATTCCTCCTGACGCTACGAAACGAGAAATGTCTGGT
GACTTTACGCCGGCGTCGGGAATTTCAGGCGATTGTGTTAACGAAGACACGGAGAAGAATACGAATGGCGTGTTAATATC
TACTTCAAGCTGCTACAATAGAGAATCACCTACGGATTCTGATTTCTCCGGTACTAGTCAGAGCTTGAGTTTTTCGGGGC
AAGATTCTGCCAAGAGGAAAACAGAGATTGAAGAAGATTCAAGCGACGAATCCAGGAGATTGGGTAAAGATGGTTTTGCA
AGTGTTATAAAAGTTGGTGGTGAAGAAGATGATGAGAAGAAGAAGAACGTGAGACTAGTTAGAAACCGTGAAAGTGCTCA
CCTTTCAAGACAGAGGAAGAAGCATTACGTGGAGGAGCTTGAAGATAAAGTTAAGAATATGCATTCCACTATATCGGAAT
TGAGCAGTAAGATGTCTTATTTCGTGGCTGAGAATGTCACTTTGAGGCAACAGATGGGCACAAGGTTCTCAAGTGGACCA
CCGATGGTTCCAATTGTTTATCCATGGATGCAGTATCCGGCTTATATGGTTAAACCACAAGGTTCTCAAGTGGCTTTGCT
TCCTATTCCTCGGTTGAAACCAAAACATTCTGTTGCTAAGGTGAAGAAGTTCAAGAAGGTTGCTAGTTTTAGTGTTTTTG
GTTTTCTGTTTTGTATGTTTTTGTTTGGTGCATTGGTGAACATTAGCTATGGGGAGTATAAGTCTAACTATGTTACTGAC
GGGGTTTATGATCAGTCTAGAGGAAGAGTTTTGGTTGTTGATAGTAGTAGAGTACATTGTGGGGGAGATTCTGATCAAGG
AGTGGGAAGAAACGTATCTGAAACAGAGAATTTGGGGCCTCCTCGAAATAGTAGTGAACCTCTAGTTGCATCGCTATTTG
TTCCGAGGAATGAAAAGCTTGTCAAGATCGATGGAAATTTGATTATTCATTCTGTTTTGGCGAGCGAGAAAGCCAGGGAT
TCTGAAACAAAGAACGAAGAAGGGAAAAGTGTTCTAGCAACTACAACTAAAACTTTATCTCCTGCATTGCCTTTACCTGA
CTCCACAAGCCCAAGGACCAGGGATGTGTCTAAGCACCTCTATAGCGAAACGGGGAAAGGCCTGTCATCTTCTGGTTCTG
ATGATGCTTCGAACGACCAACTCAAATCAACAATAGCCAATGGTAAAATGCAGCAATGGTTTCGTGAAGGTGTTGCAGGG
CCAATGTTCAGTTCGGGGATGTGCACTGAAGTGTTTCAGTTTGATGTCTCCTCAAACTCAGGAGCCATCATTCCTGCTTC
TCCACATACTCAACAGTGTAAGAACACCAGTGATACACAAAAGGGGAAAAAGAACAGAAGAATCCTCAGTGGTGGTCTTC
CGGTATCTGACTTTAATCTTACCAAAGAAGATCATAACAGCTCTAGCAAAGACAAGTTCCGGGAAACCAAGCCAGGCCCA
TCAATGGTAGTGTCTGTGCTTGTTGATCCCAGAGAAGGCGGTAATGGAGACATCGATGGGATGATGGGAGGAACAAAACC
ACAGTCCCGAGTTTTCATAGTCGTGCTTGTGGACGGTGTGAAGTATATAACATACTCTTGCGTTCTTCCACGACCAGATG
TCCCTCATCTCATGACCAGTTGA