Details for Arabidopsis Locus AT3G56650

Position : Chr3 ( 5`- 20984752 .. 20986131 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56650

Protein [Map View]
MATASLVPTSKIFSVSPKSSASIKARSRVVVASSQQQQQPRRRELLLKSAVAIPAILQLKEAPISAAREVEVGSYLPLSP
SDPSFVLFKAKPSDTPALRAGNVQPYQFVLPPNWKQLRIANILSGNYCQPKCAEPWIEVKFENEKQGKVQVVASPLIRLT
NKPNATIEDLGEPEKVIASLGPFVTGNSYDSDELLKTSIEKIGDQTYYKYVLETPFALTGSHNLAKATAKGSTVVLFVVS
ATEKQWQSSQKTLEAILDSFQL*

DNA
ATGGCGACTGCGTCTCTAGTTCCGACATCTAAAATCTTCTCTGTCTCTCCGAAATCCTCAGCTTCGATTAAAGCAAGGAG
CAGAGTAGTTGTTGCATCGTCGCAACAACAACAACAACCAAGAAGGAGAGAGCTTCTGCTGAAATCGGCGGTGGCGATTC
CGGCGATTCTGCAATTGAAGGAAGCTCCGATATCAGCGGCGCGTGAGGTGGAAGTTGGATCGTACTTACCTCTGTCTCCG
TCTGATCCTTCTTTCGTCCTGTTTAAAGCCAAACCTTCAGATACTCCTGCTCTCCGCGCAGGAAATGTTCAGCCCTATCA
GTTTGTTCTACCGCCGAATTGGAAACAGTTGCGAATAGCCAATATTTTGTCAGGTAATTACTGTCAACCGAAATGTGCAG
AGCCATGGATCGAAGTGAAGTTTGAGAACGAGAAGCAAGGCAAGGTTCAAGTAGTTGCATCTCCTTTAATCCGCTTAACC
AACAAACCAAATGCAACTATTGAAGATCTCGGTGAGCCTGAGAAAGTGATTGCTTCTCTTGGTCCTTTTGTCACCGGAAA
CTCTTATGACTCTGATGAACTTTTGAAGACTTCAATCGAAAAAATTGGAGATCAAACGTACTATAAGTATGTGTTGGAGA
CGCCATTTGCGCTCACGGGAAGTCACAATCTTGCAAAAGCGACAGCAAAGGGAAGCACGGTTGTTTTGTTTGTTGTAAGT
GCTACTGAAAAGCAATGGCAGAGCTCACAGAAGACTCTTGAAGCCATTCTTGATTCTTTTCAACTGTAA