Details for Arabidopsis Locus AT3G56630

Position : Chr3 ( 5`- 20978937 .. 20980632 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56630

Protein [Map View]
MEHFILISLLCFPIVIFFIFFPKNSSSEFGFKSYPIVGSLPGLVNNRHRFLDWTVETLSRCPTQTAIFRRPGKLQFVMTA
NPANVEYMLKTKFESFPKGERFISILEDFLGRGIFNSDGEMWWKQRKTASYEFSTKSLRDFVMSNVTVEINTRLVPVLAE
AATNGKLIDLQDILERFAFDNICKLAFNVDSACLGDDGAAGVNFMQAFETAATIISQRFQSVISYSWKIKKKLNIGSERV
LRESIMIVHKFADEIVRNRIEQGKVSDHKEDLLSRFISKEEMNSPEILRDIVISFILAGRDTTSSALSWFFWLLSMHPEV
KDKILQELNSIRERTGKRIGEVYGFEDLKLMNYLHAAITESLRLYPPVPVDTMSCAEDNVLPDGTFIGKDWGISYNAYAM
GRMESIWGKDCDRFDPERWIDETNGGFRGENPYKFPAFHAGPRMCLGKEMAYIQMKSIVAAVLERFVVEVPGKKERPEIL
MSVTLRIRGGLNVRVQERS*

DNA
ATGGAGCATTTCATCCTCATCTCCCTCCTCTGTTTCCCTATCGTCATCTTCTTCATCTTCTTCCCCAAGAATTCTTCTTC
AGAATTTGGTTTCAAGTCGTATCCGATCGTTGGAAGCTTACCTGGTCTAGTGAATAACCGTCACCGATTCCTCGACTGGA
CGGTGGAAACTCTGTCTCGATGCCCAACCCAAACGGCGATTTTTCGGCGACCAGGGAAGCTGCAGTTCGTCATGACGGCG
AATCCAGCTAACGTCGAGTATATGCTCAAGACGAAATTCGAAAGTTTCCCTAAAGGCGAACGGTTCATCTCGATTCTCGA
GGATTTTCTCGGCCGCGGGATTTTTAACTCCGACGGTGAGATGTGGTGGAAACAGAGGAAGACGGCCAGTTATGAATTCA
GTACTAAATCTCTCCGTGACTTCGTTATGAGCAACGTCACCGTCGAAATCAACACTAGGCTTGTTCCAGTGTTAGCAGAA
GCTGCAACCAACGGAAAATTGATAGATCTTCAAGACATATTGGAGCGGTTCGCGTTCGATAACATCTGTAAATTAGCTTT
CAACGTTGATTCAGCTTGTCTCGGCGACGACGGAGCAGCCGGTGTAAACTTCATGCAGGCCTTTGAAACGGCGGCGACGA
TCATCTCGCAACGGTTTCAGTCTGTGATTTCGTATTCATGGAAGATTAAAAAGAAACTCAACATTGGATCAGAGAGAGTT
CTGAGAGAATCAATCATGATCGTCCATAAATTCGCAGACGAGATCGTGCGTAACAGGATTGAACAAGGAAAGGTAAGTGA
TCACAAGGAAGATTTGCTTTCTCGGTTTATCAGCAAGGAGGAGATGAATTCTCCGGAGATACTTCGTGATATTGTCATAA
GTTTCATACTTGCAGGACGAGACACTACTTCCTCTGCTTTGAGCTGGTTCTTTTGGTTGCTCTCTATGCATCCAGAAGTG
AAAGATAAGATTCTACAAGAGCTAAACTCGATTCGAGAACGAACAGGGAAGCGAATCGGGGAAGTTTACGGGTTTGAAGA
TCTTAAACTGATGAATTATCTTCACGCAGCGATAACTGAATCTCTACGATTGTATCCGCCAGTGCCAGTGGATACAATGA
GTTGTGCTGAGGACAATGTGTTGCCTGATGGGACATTTATAGGGAAAGATTGGGGGATAAGCTATAACGCGTATGCGATG
GGGAGGATGGAGAGTATTTGGGGGAAAGATTGCGATCGGTTTGATCCTGAGAGGTGGATTGATGAAACAAATGGTGGTTT
TAGAGGTGAGAATCCTTATAAGTTTCCTGCGTTTCATGCGGGACCAAGGATGTGTTTAGGGAAGGAGATGGCTTATATTC
AGATGAAATCGATAGTCGCTGCGGTTTTAGAGAGGTTTGTGGTTGAGGTTCCAGGGAAGAAGGAGCGTCCTGAGATTCTA
ATGTCGGTGACACTTAGAATCAGAGGAGGTTTGAATGTGAGAGTACAAGAAAGATCTTGA