Details for Arabidopsis Locus AT3G56600

Position : Chr3 ( 5`- 20968444 .. 20970913 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56600

Protein [Map View]
MNCMAVALDPLTDRFSQFSRSSQRCRLQSLTNLDFNFLGFNTKQTNLSASSHSLNNRSVSTPCFSISGSNLDGSATPHIE
ILGGQRVPTVRSLVAEVTIAIVSGAQPLLLPSGLGGAYLLQTEKGNNIAVAKPVDEEPLAFNNPKGSGGLTLGQPGMKRS
IRVGESGIRELAAYLLDHQGFSSVPPTALVRISHVPFHDRGSDHAAYKVASLQRFVGHDFDAGELGPGSFTVVSVHRIGI
LDVRVLNLDRHAGNMLVKKIHDQDETTCSNGVGAAELVPIDHGLCLPECLDDPYFEWLNWPQASVPFTDIELQYISNLDP
FKDAELLRTELDSIQESSLRVLIVCTIFLKEAAAAGLSLAEIGEKMTRDICRGEESSSVLEILCNKAKASAVSGSDDDDD
YSSEWNEVEAELECGIFQFDDEVECKELPDMLQVPIFTRVPSIAANLSALMRCPPNQWISTYDTNIEEERRDRSIVRSKS
HPICVNYDEKEGVYFGDMSGDEWEMFLHSFQMLLPEALEGSTSKGPKPRFGSSCKF*

DNA
ATGAACTGTATGGCCGTCGCTCTCGATCCACTAACCGACCGGTTTTCGCAGTTTAGCCGATCTTCACAGAGATGTAGACT
CCAATCTTTAACCAACCTTGACTTCAACTTTCTCGGATTCAACACTAAACAAACCAATCTCTCTGCTTCCTCACACTCCT
TGAACAACCGAAGCGTTTCTACTCCATGCTTCTCCATATCCGGTAGTAATCTAGATGGCTCTGCTACTCCGCACATTGAG
ATTCTCGGTGGTCAAAGAGTCCCCACTGTACGTTCCCTTGTAGCTGAAGTAACCATAGCTATCGTTTCTGGAGCTCAGCC
TCTGCTTTTACCAAGTGGTTTAGGAGGTGCATATCTCTTGCAAACCGAAAAAGGTAACAACATTGCGGTTGCAAAACCAG
TCGATGAAGAGCCTTTAGCTTTCAACAATCCTAAAGGATCTGGCGGTTTAACACTCGGGCAACCAGGCATGAAACGGTCT
ATCCGCGTTGGTGAAAGCGGAATCCGTGAATTGGCTGCTTACCTTTTAGACCACCAAGGCTTTTCCAGTGTTCCACCAAC
CGCATTGGTCAGAATCTCTCATGTTCCGTTCCATGACAGAGGTAGTGATCACGCCGCCTATAAAGTTGCCTCTTTGCAAC
GATTTGTGGGTCATGATTTTGATGCAGGAGAGCTTGGACCAGGAAGCTTCACGGTTGTATCGGTCCATAGGATTGGTATA
CTTGATGTGAGAGTCTTGAACCTTGACAGACACGCCGGAAACATGTTGGTGAAGAAGATACATGACCAAGATGAGACTAC
TTGTTCTAACGGAGTTGGAGCTGCAGAGCTTGTGCCTATAGATCATGGTCTTTGCCTACCTGAATGCCTCGATGATCCTT
ATTTCGAATGGCTTAACTGGCCTCAAGCTTCGGTGCCATTCACCGACATTGAGCTTCAGTATATATCAAACTTGGACCCT
TTCAAAGACGCAGAGCTTTTGAGAACAGAACTAGACTCTATACAGGAATCTTCCCTACGGGTTCTTATCGTCTGCACGAT
ATTCTTGAAAGAAGCTGCTGCTGCAGGGCTTAGTCTTGCAGAGATAGGAGAGAAGATGACTCGGGACATATGCAGAGGGG
AAGAGAGTTCTAGTGTGTTGGAGATTCTTTGCAACAAAGCAAAAGCAAGCGCGGTTAGTGGAAGTGACGATGATGATGAT
TATAGTAGTGAATGGAATGAAGTAGAAGCAGAGCTAGAGTGTGGAATTTTTCAGTTTGACGATGAAGTTGAATGCAAAGA
GCTTCCAGATATGTTACAAGTGCCTATATTCACAAGAGTTCCATCCATTGCTGCCAATCTATCTGCTCTCATGCGGTGTC
CACCAAACCAGTGGATTAGTACATATGACACTAACATAGAAGAGGAAAGGAGAGATCGGAGTATCGTGAGGAGCAAGAGT
CACCCGATATGTGTGAATTATGATGAGAAAGAAGGTGTTTATTTTGGGGACATGAGTGGAGATGAATGGGAGATGTTCTT
GCATAGTTTCCAGATGCTTTTGCCAGAAGCACTTGAAGGCTCAACAAGCAAGGGACCAAAACCAAGATTTGGATCTTCTT
GTAAATTCTAA