Details for Arabidopsis Locus AT3G56590

Position : Chr3 ( 5`- 20964857 .. 20968019 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56590

Protein [Map View]
MGKNTVEEQNLPVSDGAASARNNGGGGISTCCCCDWISSYFSLRCVLILAFSAAVFLSALFWLPPFLGFADPGDLDLDPR
FKDHRIVASFDVGKPISFMEDNLMQLENDITDEISFPMTKVVVLALERLGDLNRTMVIFAIDPEKENSKIPAEIESLIKA
AFETLVQKQLSFRLTESLFGEPFFFEVLKFPGGITVIPPQPIFPLQKAQLLFNFTLNFSIYQIQSNFEELASQLKKGINL
ASYENLYITLSNSRGSTVAPPTIVHSSVLLTFGSSSRLKQLAQTITSSHSKNLGLNHTVFGKVKQVRLSSILPHSPATSS
TPSPSPQPETHQYPHHHPHHHHHHHELAPEPSLSPPTKGFAPASAPTKHSPLPPRNPPCPYEQRRPKGNSALNHHTAPPT
PAPHRSQPHPPAPNPAPPRHHAIPVSSPLPHVVFAHIPPPSKSSPESEPTGEKSPSPAPTPSSASIGPTFKKASSQLLVV
VVAVIIICL*

DNA
ATGGGGAAGAATACCGTCGAGGAGCAGAATCTCCCTGTGAGCGACGGAGCTGCTTCGGCTAGGAATAACGGAGGTGGAGG
AATAAGCACATGTTGTTGCTGCGATTGGATCTCTAGCTACTTTAGTCTCAGATGCGTTTTGATTCTTGCTTTTTCTGCTG
CTGTGTTTCTCTCCGCCTTGTTTTGGTTACCTCCATTCCTCGGATTTGCAGATCCAGGGGATCTAGATCTCGATCCAAGG
TTTAAAGATCACAGAATAGTGGCGAGTTTTGATGTTGGAAAACCAATTTCGTTCATGGAAGACAATTTGATGCAGCTTGA
GAATGATATCACTGATGAAATAAGCTTTCCCATGACCAAAGTTGTGGTATTAGCGCTTGAACGCTTGGGTGATCTTAACA
GAACAATGGTTATTTTTGCCATTGATCCTGAGAAGGAGAATTCTAAGATACCTGCCGAAATAGAGAGTCTGATCAAGGCA
GCTTTTGAAACTCTGGTCCAAAAGCAGTTGTCTTTCCGTTTGACTGAATCCTTGTTTGGGGAACCATTCTTTTTCGAGGT
GCTAAAATTCCCTGGAGGAATCACTGTGATCCCTCCCCAGCCTATATTTCCCCTGCAGAAGGCCCAACTTCTTTTCAACT
TCACATTAAACTTTTCGATTTACCAAATTCAATCAAACTTTGAGGAACTCGCTAGCCAGCTGAAGAAGGGCATAAATCTG
GCTTCCTATGAGAACTTGTACATAACCTTGTCAAATTCCAGAGGTTCAACAGTGGCGCCTCCTACTATAGTTCATTCTTC
TGTTCTACTCACATTCGGTTCATCTTCGAGGTTGAAGCAACTTGCTCAAACTATCACTAGCTCCCATTCCAAAAATCTCG
GCCTAAACCATACCGTATTTGGTAAGGTTAAGCAAGTCCGTCTTTCCTCAATCTTGCCACATTCACCTGCCACATCATCA
ACCCCTTCCCCTTCTCCTCAACCTGAAACCCACCAATACCCCCATCATCATCCTCATCATCATCACCACCATCATGAACT
TGCTCCAGAACCTTCACTCTCACCTCCAACTAAAGGCTTTGCACCTGCATCAGCGCCAACCAAACACTCACCTTTACCCC
CGAGAAACCCGCCTTGCCCTTACGAGCAGAGGAGACCAAAAGGAAACAGTGCTCTAAACCATCATACTGCACCACCAACG
CCTGCACCACACCGGTCTCAGCCACACCCACCAGCACCAAACCCAGCCCCGCCACGTCATCATGCCATACCAGTATCTAG
CCCACTTCCCCACGTTGTATTTGCTCATATCCCACCTCCATCAAAAAGCAGCCCAGAATCAGAACCTACAGGCGAAAAAT
CTCCCTCACCTGCTCCAACCCCATCTTCTGCGAGCATTGGTCCAACCTTCAAAAAGGCATCATCACAGCTCCTTGTAGTA
GTAGTAGCCGTCATAATCATCTGTCTGTAA