Details for Arabidopsis Locus AT3G56580

Position : Chr3 ( 5`- 20961551 .. 20963749 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56580

Protein [Map View]
MSSIRNTHWCHRCQRAVWLRARDAVCSYCGGGFVEEIDIGPSRAHRDVERDPTFDLMEAFSAFMRSRLAERSYDREISGR
LGSAGSESFSNLAPLLIFGGQAPFRLAGGDNSSVEAFVNGAAPGIGIARGTNAGDYFFGPGLEELIEQLSSGTHHRGPPP
APKSSIDALPTIKITQKHLKSSDSHCPVCKDEFELKSEAKQMPCHHIYHSDCIVPWLVQHNSCPVCRKELPSRGSSSSTQ
SSQNRSTNGRENSRRRNIFSNLWPFRSSSSSSTQNRRDTNNTATAEEGHYHHHQQQQQQHQHQHQQQQSHMGYSGWPFDY
*

DNA
ATGTCAAGTATTCGGAATACTCATTGGTGTCACAGATGTCAACGTGCTGTTTGGCTTCGAGCTCGAGATGCTGTCTGTTC
ATATTGTGGAGGAGGGTTTGTTGAGGAAATCGATATAGGACCGAGTAGAGCTCACAGGGATGTTGAGCGTGATCCAACCT
TTGATCTCATGGAAGCTTTCTCAGCCTTTATGAGAAGCCGTTTAGCTGAAAGAAGCTATGACCGAGAAATCAGCGGAAGA
CTTGGCTCTGCGGGTTCTGAAAGCTTTTCAAACTTGGCTCCTCTATTGATCTTTGGTGGCCAAGCTCCCTTTCGATTGGC
TGGTGGTGATAATAGTTCAGTTGAAGCCTTTGTCAATGGCGCAGCACCTGGAATTGGTATCGCACGTGGCACCAATGCCG
GAGACTATTTTTTTGGACCCGGTCTTGAAGAACTGATTGAACAGCTTTCCTCAGGCACTCATCACCGAGGCCCACCACCA
GCACCGAAATCATCAATTGATGCATTGCCAACCATCAAGATCACACAGAAGCATCTCAAGTCATCAGACTCTCACTGCCC
GGTTTGCAAAGACGAGTTCGAACTGAAATCAGAAGCAAAACAGATGCCGTGTCACCATATCTATCATTCTGACTGCATTG
TCCCGTGGCTGGTTCAGCATAACTCATGCCCAGTCTGTCGTAAAGAGTTGCCATCCAGAGGATCTTCTTCAAGCACACAG
AGTAGTCAGAACAGAAGCACCAATGGAAGAGAAAACAGCAGAAGAAGGAACATTTTCTCTAACCTCTGGCCATTCCGCTC
GTCTAGCTCAAGCTCGACTCAAAACCGCAGAGACACAAACAACACAGCAACTGCAGAAGAAGGCCACTATCATCATCACC
AGCAGCAACAGCAACAACATCAACATCAACATCAACAACAACAATCCCATATGGGTTACAGTGGATGGCCTTTTGACTAT
TAA