Details for Arabidopsis Locus AT3G56550

Position : Chr3 ( 5`- 20952292 .. 20954641 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56550

Protein [Map View]
MCEKARVIVRMLQGCNSMKKLRKIHSHVIINGLQHHPSIFNHLLRFCAVSVTGSLSHAQLLFDHFDSDPSTSDWNYLIRG
FSNSSSPLNSILFYNRMLLSSVSRPDLFTFNFALKSCERIKSIPKCLEIHGSVIRSGFLDDAIVATSLVRCYSANGSVEI
ASKVFDEMPVRDLVSWNVMICCFSHVGLHNQALSMYKRMGNEGVCGDSYTLVALLSSCAHVSALNMGVMLHRIACDIRCE
SCVFVSNALIDMYAKCGSLENAIGVFNGMRKRDVLTWNSMIIGYGVHGHGVEAISFFRKMVASGVRPNAITFLGLLLGCS
HQGLVKEGVEHFEIMSSQFHLTPNVKHYGCMVDLYGRAGQLENSLEMIYASSCHEDPVLWRTLLGSCKIHRNLELGEVAM
KKLVQLEAFNAGDYVLMTSIYSAANDAQAFASMRKLIRSHDLQTVPGWSWIEIGDQVHKFVVDDKMHPESAVIYSELGEV
INRAILAGYKPEDSNRTAPTLSDRCLGSADTSHSEKLAIAYGLMRTTAGTTLRITKNLRVCRDCHSFTKYVSKAFNREII
VRDRVRFHHFADGICSCNDYW*

DNA
ATGTGCGAAAAAGCGAGAGTGATAGTGAGAATGCTACAAGGATGCAACAGTATGAAGAAGCTCCGTAAGATCCATTCTCA
TGTCATCATCAATGGTCTCCAACATCATCCTTCCATCTTCAACCACCTCCTCCGCTTCTGCGCCGTCTCCGTCACTGGTT
CTTTATCTCACGCTCAACTTCTCTTCGACCATTTCGATTCCGATCCATCAACATCGGATTGGAACTACCTTATTCGTGGC
TTCTCCAATTCTTCTTCTCCTCTAAATTCGATTCTCTTCTATAACCGAATGCTTCTCTCCTCTGTTTCACGTCCTGATCT
CTTCACTTTCAATTTCGCTCTCAAATCATGTGAGAGGATTAAATCGATTCCGAAATGTTTGGAGATTCACGGTTCGGTTA
TTCGATCTGGGTTTCTTGATGACGCTATTGTTGCCACTAGTCTCGTTCGTTGTTACTCTGCGAATGGAAGTGTTGAGATT
GCATCTAAAGTGTTCGACGAAATGCCTGTTAGAGACTTGGTTTCTTGGAACGTTATGATCTGTTGCTTTTCTCATGTTGG
TTTACATAATCAAGCGTTGAGTATGTACAAGCGAATGGGAAATGAAGGTGTGTGTGGTGACTCTTACACGCTCGTTGCTT
TGTTATCTTCTTGTGCTCACGTTAGTGCTTTGAATATGGGAGTTATGCTACACAGGATAGCCTGTGATATTCGATGTGAG
AGTTGTGTCTTTGTGAGTAATGCTCTTATTGATATGTATGCAAAATGTGGTAGCCTTGAAAATGCTATTGGTGTGTTTAA
CGGGATGCGAAAAAGAGATGTGTTGACCTGGAACTCAATGATTATTGGGTATGGAGTTCACGGGCATGGCGTAGAGGCCA
TCTCGTTCTTCAGAAAGATGGTGGCTTCCGGGGTTAGACCCAATGCCATCACATTCCTTGGATTGTTGTTAGGTTGTAGT
CATCAAGGTCTAGTTAAAGAAGGAGTTGAGCATTTTGAAATCATGAGTTCACAGTTCCATTTGACTCCGAACGTCAAACA
CTATGGATGCATGGTGGATCTCTATGGACGAGCAGGTCAGCTAGAAAACTCCCTCGAGATGATATATGCGTCTTCCTGCC
ATGAGGATCCCGTCTTGTGGAGAACCCTGCTTGGCTCTTGCAAAATCCACAGGAATTTGGAATTAGGAGAAGTAGCCATG
AAGAAATTGGTGCAGCTTGAGGCTTTCAATGCAGGGGACTATGTGCTTATGACTTCGATATATTCTGCAGCGAATGATGC
GCAAGCTTTTGCTAGTATGAGAAAACTAATAAGAAGCCATGATTTACAGACAGTTCCAGGATGGAGTTGGATTGAGATTG
GTGATCAAGTTCACAAATTTGTCGTTGATGACAAAATGCATCCGGAGTCTGCAGTTATTTACTCAGAACTCGGGGAAGTA
ATCAACCGTGCCATTCTAGCTGGATACAAGCCAGAGGACTCAAACAGAACTGCTCCTACTCTCTCTGATCGGTGTTTAGG
ATCTGCAGATACATCTCATAGTGAAAAATTGGCTATTGCATATGGATTAATGCGAACTACTGCAGGAACAACTCTCCGAA
TCACAAAGAATCTGAGAGTTTGCAGAGATTGTCATTCGTTTACAAAATATGTATCAAAAGCATTCAATCGGGAAATTATT
GTAAGGGATAGAGTTCGATTTCATCACTTTGCAGATGGTATTTGTTCTTGCAACGACTACTGGTGA