Details for Arabidopsis Locus AT3G56540

Position : Chr3 ( 5`- 20950823 .. 20951892 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56540

Protein [Map View]
MGKLQDWSITTCLFLFFLHASQTHCTSQSHVRNRLYRSKRGIGSSIDTSHLNAIRRLSVSLSLQNISGVNQQEQKERDLI
ENLPGQPSVNFKQYGGYVTVNESAGRSLYYYFVEATNTKNSSPLVLWLNGGPGCSSLYGAFQELGPFRVHSDNKTLYTNP
YSWNNVANMLFLESPAGTGFSYTNTTTDMENPGDMKTAADNYVFLVKWLERFPEYKGRDFYIAGESYAGHYVQWRHGCGD
FGDSYNVRTEDDESNGCYGMASVV*

DNA
ATGGGAAAACTACAAGACTGGTCTATAACCACTTGTCTCTTCCTTTTCTTTTTGCATGCATCACAAACCCATTGCACCAG
CCAATCACATGTTAGAAACCGTCTATACCGATCAAAGCGAGGGATTGGTTCGTCAATAGACACAAGCCACTTAAATGCGA
TTCGTCGTTTAAGCGTGTCTTTGTCGCTCCAAAACATAAGCGGTGTTAACCAACAAGAGCAAAAGGAAAGAGATCTAATT
GAGAATCTTCCCGGACAGCCTTCAGTTAATTTTAAGCAATATGGCGGTTATGTGACCGTGAATGAGTCAGCAGGTCGATC
CTTGTACTATTATTTCGTGGAAGCCACCAATACCAAAAACTCATCACCCCTTGTTCTATGGCTAAACGGAGGACCGGGCT
GCTCCTCTCTGTATGGGGCATTTCAAGAGCTTGGTCCATTCCGCGTACATAGCGACAACAAAACACTCTATACCAATCCT
TATTCATGGAACAACGTGGCGAACATGTTATTCTTAGAATCTCCGGCAGGAACGGGATTCTCATACACGAACACAACAAC
GGATATGGAGAATCCCGGGGACATGAAAACAGCAGCTGATAACTACGTTTTCTTGGTGAAATGGCTGGAGAGGTTTCCGG
AATATAAAGGAAGAGATTTTTACATCGCTGGTGAGAGTTACGCCGGTCACTATGTTCAGTGGAGACACGGATGCGGTGAT
TTCGGTGACAGTTACAATGTACGCACTGAAGATGATGAATCTAACGGCTGTTACGGAATGGCTTCCGTGGTTTAG