Details for Arabidopsis Locus AT3G56530

Position : Chr3 ( 5`- 20948911 .. 20950045 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56530

Protein [Map View]
MAIPQRNKRKARSSPERLTQPPELPHNSDVPSSSSSSAADNFFSWSTKQFAFPPGYRFVPKDQELIFHYLKPFSQGNKCS
LLNVPIHRVNIYESNPQHLSEKYEKGNDKDWFYISERTKTGKAGRSNKRVDNGGYWSATVAAQKINAGNGIVGYKTSLEY
YVGKQSNSVKGDWLMQEYWFESSDDNNNEKVDHALCKIYLTPAAAKKKKAEEAENEKLKKEEDVEQLDLNQPDQLQLQQP
HDIVYQPQYCLLPEHHQPQPFPDNFSELISFQQQPVMIPDDFEDFLAEFTKPHSLDGDEEFNNYGLFEGFFDTEGMIKH*

DNA
ATGGCGATTCCACAAAGAAACAAGCGCAAAGCAAGATCCTCGCCGGAACGGCTAACACAACCGCCGGAACTACCACACAA
CTCCGACGTTCCTTCTTCTTCGTCTTCTTCTGCCGCTGATAATTTCTTTTCTTGGTCGACGAAACAGTTTGCTTTCCCGC
CAGGTTATAGATTTGTACCAAAGGACCAAGAACTCATCTTTCATTACTTGAAACCCTTTTCGCAAGGCAATAAATGCTCA
TTGCTCAATGTTCCTATCCATCGTGTGAACATCTACGAGTCAAATCCACAACATCTTTCAGAGAAATATGAGAAGGGTAA
TGATAAAGATTGGTTCTATATATCGGAGAGGACCAAGACCGGTAAGGCTGGAAGAAGTAATAAACGTGTCGACAATGGAG
GATATTGGAGCGCAACTGTAGCTGCCCAAAAGATCAACGCTGGAAATGGCATAGTCGGCTACAAGACTTCACTAGAGTAC
TATGTTGGGAAACAATCAAATAGTGTCAAAGGGGATTGGTTAATGCAAGAGTACTGGTTTGAGTCTTCTGATGATAACAA
CAACGAGAAGGTGGATCATGCTTTGTGCAAGATTTATCTGACTCCAGCGGCAGCAAAGAAGAAGAAAGCTGAGGAAGCAG
AGAATGAGAAGCTGAAGAAAGAAGAAGACGTTGAGCAGCTGGATTTGAATCAACCAGACCAATTGCAGCTGCAACAGCCT
CATGATATTGTGTATCAACCGCAGTATTGTTTACTTCCAGAACATCATCAGCCGCAGCCTTTTCCTGATAACTTTTCTGA
GTTGATCAGCTTTCAACAGCAACCAGTGATGATCCCAGACGATTTTGAAGATTTCTTGGCTGAATTCACTAAACCACATT
CACTGGATGGAGATGAAGAATTCAACAATTATGGTTTGTTTGAAGGCTTCTTTGACACAGAAGGAATGATAAAACATTAA