Details for Arabidopsis Locus AT3G56520

Position : Chr3 ( 5`- 20947107 .. 20947731 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56520

Protein [Map View]
MEPTHRALPVGFRFRSTNCEISNYFLKKKALGQPMKARTIPEECHDIFSRHPHDLPGYPSEEHWYYFCRKRDNQVTSNSH
NLWTPIGEETNVLDPKNNDALVGIKRRFTLIAQEEEESDNICLSDDEEALKYNWFMDEISLPQTVANTDWVLCHIFGKKT
KPETTDLSTIDSESE*

DNA
ATGGAGCCAACACACAGAGCTTTGCCCGTAGGATTCAGGTTTCGTTCTACAAACTGTGAGATTTCAAACTATTTTTTGAA
GAAAAAAGCTTTAGGACAACCCATGAAAGCTCGTACGATACCTGAAGAGTGTCATGATATCTTCTCAAGACATCCGCATG
ATCTGCCTGGTTATCCAAGTGAAGAACATTGGTACTATTTTTGCAGAAAACGTGACAACCAAGTTACTAGTAACTCTCAT
AATCTCTGGACACCAATCGGAGAAGAAACCAATGTGCTAGATCCAAAGAATAATGATGCATTAGTTGGTATTAAGCGTCG
GTTTACTCTTATTGCGCAAGAAGAAGAAGAATCTGATAATATTTGTTTATCTGATGATGAAGAAGCTTTAAAGTATAATT
GGTTCATGGATGAAATTAGCCTCCCACAAACAGTAGCGAATACTGATTGGGTTTTATGCCATATTTTTGGCAAGAAGACT
AAACCCGAAACTACTGATTTGTCCACAATCGATTCCGAATCCGAATAG