Details for Arabidopsis Locus AT3G56510

Position : Chr3 ( 5`- 20943928 .. 20946661 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56510

Protein [Map View]
MQSEESHELTDGISEEKESKETMKSQKADRKKKKLKEKLLKEASKADNRGVCYLSRIPPHMDHVRLRHILAQYGELGRIY
LAPEDSEAQVHRKRAGGFRGQRFSEGWVEFAKKSVAKRVADMLNGEQIGGKKKSSVYYDIWNIKYLTKFKWDDLTEEIAY
KSAIREQKLNMVLSAAKREKDFYLSKIEKSRAMTEIDARMEKKRKIQEESGSNAEAAPVFPPRAIFQFRQKKSIENETSQ
SKPGLSTDFLASVFGGS*

DNA
ATGCAGAGTGAGGAATCTCACGAGCTTACGGATGGAATATCCGAGGAGAAGGAGTCCAAGGAAACGATGAAGAGTCAAAA
GGCTGATAGAAAGAAAAAGAAGTTGAAAGAGAAATTGCTTAAGGAAGCTTCGAAAGCTGACAATAGAGGTGTTTGCTACT
TAAGTCGTATCCCACCACACATGGATCACGTTAGACTTCGCCATATTCTCGCTCAATATGGAGAACTCGGAAGGATTTAT
CTTGCACCTGAAGATTCTGAAGCACAAGTGCACCGTAAGCGGGCTGGTGGATTTCGTGGCCAAAGGTTTTCTGAAGGGTG
GGTGGAGTTTGCTAAGAAGAGCGTAGCTAAACGGGTTGCAGATATGCTAAATGGAGAACAAATCGGGGGGAAAAAGAAGT
CATCAGTATACTATGATATTTGGAACATCAAATACTTGACCAAATTTAAATGGGATGATCTTACTGAAGAAATCGCATAC
AAAAGTGCAATACGGGAACAGAAATTAAATATGGTTCTTTCTGCTGCAAAGAGGGAGAAAGACTTTTATCTATCTAAAAT
AGAGAAGTCTCGTGCCATGACCGAGATAGATGCACGAATGGAAAAGAAACGAAAGATTCAAGAAGAATCGGGTAGCAATG
CTGAAGCAGCACCAGTCTTTCCACCTAGGGCGATTTTCCAGTTTAGACAGAAGAAATCAATTGAAAATGAGACATCTCAA
AGCAAGCCTGGGCTCTCCACTGATTTCCTAGCATCGGTATTTGGCGGTTCTTAA