Details for Arabidopsis Locus AT3G56480

Position : Chr3 ( 5`- 20936098 .. 20939631 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56480

Protein [Map View]
MTKVCPEIEGTLSLSVVPVSVDVSFASDHFPTYKLGPDNQIVEEPKEDEKGPSVKETVEKESELLSDQHKRLSVRDLASK
FDKNLAAAVSLANEAKLREVASLEGHVMLKKLRDALEYMRGRTDGQNKQDVETAISMVEALAVKLTQNEGELIQEKFEVK
KLGNFLKQTSEDAKKLVNQEKSFSCAEIETARAVVLRLGEAFEEQERISEASRAQGPDVEKLVEEVQEARQIKRMHHPTK
VMGMQHELHGLRNRIQEKYMNSVKLHKEIAIIKRVEESKSCPFVLEGKQSLGSCLRIRVNAQDNAPDLSNCSIQWYRAAC
ETSRREAISGAIQSMYAPEPFDVGRILQADILSNGQKFTVTTDDPVDPDSGLPSRVESLMRKSNSEFSVVISQMNGQDYA
SRSHVFTVGKTRIKLSRGWITKARELYSTSMQLCGVRGNIKAPTKAVFWQPRKSLTFILTFESEHERNAAIALARKYAFD
CSVTLLGPDD*

DNA
ATGACGAAAGTGTGTCCTGAAATAGAAGGGACATTATCTTTATCAGTGGTTCCAGTATCAGTAGATGTGAGCTTTGCTTC
TGATCACTTTCCAACATATAAATTAGGACCTGATAATCAGATAGTAGAGGAACCAAAGGAAGATGAAAAAGGTCCATCTG
TGAAGGAGACTGTCGAGAAAGAGAGCGAGTTGTTGTCTGATCAGCACAAGCGGCTTTCGGTCCGTGACCTCGCTAGTAAA
TTCGACAAGAATCTTGCTGCAGCTGTTAGTTTGGCTAATGAGGCTAAGTTAAGAGAGGTGGCTTCTTTGGAGGGACATGT
TATGTTGAAGAAGCTAAGGGATGCTTTAGAATACATGAGAGGACGCACGGATGGGCAAAACAAACAGGATGTGGAGACAG
CTATCTCCATGGTGGAAGCTCTAGCTGTGAAGTTAACTCAGAATGAAGGTGAATTGATTCAGGAGAAGTTTGAAGTGAAG
AAACTAGGAAACTTCCTCAAGCAGACTTCAGAAGATGCAAAGAAACTGGTAAATCAAGAAAAGTCATTCTCTTGTGCTGA
GATCGAAACTGCAAGGGCCGTTGTGCTGAGACTTGGAGAGGCTTTTGAAGAACAAGAACGGATTTCTGAAGCTTCTAGAG
CTCAGGGGCCGGATGTGGAGAAATTGGTTGAGGAAGTTCAAGAGGCTAGGCAAATCAAACGGATGCATCACCCAACAAAG
GTGATGGGCATGCAACACGAGCTTCATGGTTTAAGGAATCGAATCCAAGAGAAGTATATGAATTCTGTTAAACTTCATAA
AGAGATAGCAATAATCAAGAGAGTTGAGGAATCCAAGTCTTGTCCATTTGTTCTTGAAGGCAAACAAAGTCTCGGCTCTT
GCTTAAGAATCCGTGTCAATGCTCAAGACAATGCTCCAGATCTTTCCAACTGTTCTATTCAGTGGTATCGTGCAGCATGT
GAAACTAGTCGCAGGGAAGCTATATCTGGTGCCATCCAATCGATGTATGCTCCAGAACCATTTGATGTTGGGAGGATATT
ACAGGCAGACATTCTTTCAAATGGTCAAAAGTTCACAGTTACAACCGATGATCCAGTTGATCCTGATTCTGGCTTGCCAT
CCCGCGTAGAGTCGCTGATGCGAAAGTCTAACAGTGAATTCAGTGTGGTTATATCGCAGATGAATGGACAAGACTATGCA
TCTCGATCGCACGTTTTTACCGTTGGAAAGACGAGGATAAAGCTGTCTCGAGGATGGATCACAAAGGCGAGAGAATTATA
TTCGACATCCATGCAGCTCTGTGGAGTTAGAGGCAATATTAAGGCTCCTACCAAGGCAGTGTTCTGGCAACCAAGAAAGA
GTCTAACTTTCATACTAACCTTTGAGTCAGAACACGAACGTAACGCAGCCATAGCCCTTGCTCGAAAATACGCTTTCGAT
TGCAGTGTTACACTGCTTGGTCCAGATGATTAA