Details for Arabidopsis Locus AT3G56460

Position : Chr3 ( 5`- 20932791 .. 20934540 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56460

Protein [Map View]
MEALVCRKLGDPTATNPGSPESPVEVSKTHPIPSLNSDTSVRVRVIATSLNYANYLQILGKYQEKPPLPFIPGSDYSGIV
DAIGPAVTKFRVGDRVCSFADLGSFAQFIVADQSRLFLVPERCDMVAAAALPVAFGTSHVALVHRARLTSGQVLLVLGAA
GGVGLAAVQIGKVCGAIVIAVARGTEKIQLLKSMGVDHVVDLGTENVISSVKEFIKTRKLKGVDVLYDPVGGKLTKESMK
VLKWGAQILVIGFASGEIPVIPANIALVKNWTVHGLYWGSYRIHQPNVLEDSIKELLSWLSRGLITIHISHTYSLSQANL
AFGDLKDRKAIGKVMIALDHKTALSSKL*

DNA
ATGGAGGCTTTGGTTTGCCGGAAATTGGGAGATCCAACTGCGACGAATCCAGGTAGTCCAGAATCTCCGGTAGAAGTAAG
CAAGACTCATCCGATCCCGTCTTTGAATTCAGACACGTCGGTGAGAGTCAGAGTTATTGCTACGAGCTTGAATTACGCAA
ATTACCTTCAGATTCTCGGGAAATACCAGGAGAAACCTCCGTTACCTTTCATTCCGGGCTCTGATTACTCCGGAATCGTC
GACGCGATTGGTCCCGCCGTCACCAAATTCCGCGTTGGAGATCGTGTCTGTTCTTTCGCCGATCTCGGTTCCTTCGCTCA
GTTTATCGTCGCTGATCAATCTCGTTTGTTCCTTGTACCGGAAAGATGTGACATGGTTGCTGCAGCTGCGCTTCCTGTTG
CGTTTGGGACTTCTCATGTAGCACTTGTTCATAGAGCTCGTTTAACATCTGGTCAGGTCTTATTGGTTCTAGGTGCTGCT
GGTGGCGTTGGCCTTGCAGCTGTTCAAATCGGTAAGGTTTGTGGAGCCATTGTCATTGCAGTTGCTAGAGGAACTGAGAA
GATTCAACTGTTGAAGTCAATGGGAGTGGATCATGTTGTTGATCTAGGCACTGAGAATGTTATTTCAAGTGTGAAAGAGT
TTATCAAGACAAGAAAGCTTAAAGGAGTTGATGTTCTGTATGATCCTGTTGGAGGGAAACTAACCAAGGAGTCCATGAAA
GTTCTGAAATGGGGAGCCCAGATTCTGGTGATAGGTTTCGCCAGCGGCGAAATACCTGTCATTCCTGCTAATATAGCACT
TGTTAAGAACTGGACGGTTCATGGTCTTTACTGGGGTAGCTACAGGATCCATCAGCCCAATGTCCTTGAAGATTCCATCA
AAGAGTTATTGTCATGGCTTTCCCGAGGATTGATCACTATTCACATCTCTCATACCTATAGCCTCTCCCAGGCCAATCTT
GCATTCGGGGACCTCAAAGACAGGAAGGCAATTGGAAAAGTGATGATTGCTCTCGACCACAAGACTGCCCTGTCTTCAAA
ACTATAG