Details for Arabidopsis Locus AT3G56440

Position : Chr3 ( 5`- 20926001 .. 20928988 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56440

Protein [Map View]
MDPRRNFQPGGYDSRNTFTSGSFGPPDFGESDEAELVSVSWNQDYSCFAAGTSHGFRIYNCEPFKETFRRELKDGGFKIV
EMLFRSNILALVGGGPNSQYPSNKVLIWDDHQGRCISEFTFRSEIRAVKLRRDRIVVVLEHKIYVYNFMDLRLLHQIENM
ANPRGLCCLSHHMNTSVLACPGIRRGEVRVEHFGLNMVQIINAHDSNIACMTLTLDGLLLATASTKGTLIRIFNTMDGTR
LQEVRRGVDRADIYSIALSPNVQWLAVSSDKGTVHIFSLRVRVIGEDAYSTEHETSSNSLQPLVSPASGANPGSSLSFLR
GVLPKYFSSEWSFSQFHVPEVTQYFAAFGAQNTIAIIGLDGSFYRCNFDPVNGGEMTQLEHFHFLKQDSPR*

DNA
ATGGATCCTCGGAGAAACTTCCAACCAGGTGGCTATGACTCTCGGAATACCTTCACTTCAGGATCTTTTGGGCCTCCAGA
TTTTGGTGAAAGTGATGAAGCAGAGTTGGTTTCTGTTTCTTGGAATCAGGATTACAGTTGTTTTGCTGCTGGCACTAGCC
ATGGTTTTCGTATATATAACTGTGAACCGTTCAAGGAAACTTTTAGGCGAGAGCTGAAGGATGGAGGGTTTAAAATTGTA
GAGATGCTTTTCCGGAGTAATATCTTGGCGCTTGTTGGTGGTGGACCTAACTCCCAGTACCCTTCAAATAAAGTATTGAT
TTGGGATGATCATCAGGGGCGCTGCATCAGTGAGTTTACTTTTCGGTCGGAAATTCGTGCAGTGAAGTTAAGAAGAGATC
GAATTGTTGTTGTTCTTGAGCACAAGATATATGTCTACAATTTTATGGATCTAAGACTTCTTCATCAGATTGAAAATATG
GCAAATCCAAGGGGACTATGTTGCCTCTCTCATCACATGAATACATCTGTCTTGGCTTGTCCAGGTATTCGTCGAGGAGA
GGTCCGAGTTGAACATTTTGGGCTTAACATGGTTCAAATCATTAATGCTCATGATTCTAATATCGCGTGCATGACCTTGA
CATTGGATGGCTTGCTCCTTGCAACTGCCAGTACAAAGGGAACTCTGATTAGAATTTTCAACACGATGGACGGAACTCGT
CTGCAAGAGGTCCGAAGAGGCGTGGACAGAGCAGATATCTATAGCATTGCTCTATCACCAAACGTGCAGTGGCTTGCAGT
ATCAAGCGACAAGGGGACTGTTCACATTTTCTCTCTCAGAGTGAGAGTTATAGGGGAGGACGCATACTCCACTGAACATG
AGACTTCTTCAAATTCCCTGCAGCCTCTTGTTTCTCCAGCCAGTGGTGCCAACCCTGGTTCGTCATTGTCTTTTCTGAGA
GGTGTTCTACCAAAATATTTCAGCTCGGAATGGTCATTTTCTCAGTTCCATGTACCTGAAGTCACCCAATACTTTGCAGC
ATTTGGTGCTCAGAACACAATTGCAATTATTGGCTTGGACGGAAGTTTCTACAGGTGCAATTTCGATCCAGTGAACGGAG
GAGAGATGACTCAGCTTGAACATTTCCATTTTCTGAAGCAAGATAGCCCGAGATAG