Details for Arabidopsis Locus AT3G56410

Position : Chr3 ( 5`- 20916172 .. 20921338 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56410

Protein [Map View]
MMKKKKQSRSQSSSTKKTFEPSSDSSPSPRLLSIIRSKLASSKDLKHMFRGMRSRTVPGLSSQSRIVRCPKCHKLLQEPL
DATSYKCGGCDSILHAKRWEPDGNDHTNTIPEALLSSQNRSLSAEVESPEDGSRTPMRTTHREYNSRPSTSVERGYHPET
VYKPETSDIRREWMRRTDDFSETGDSDVFTSERSSPYNTRSNAAQWAQHEGRYADPPRVPFYPASPSPSSAYEYGYSSPF
HGSYVSASEQSYYHQQPNQFEQYSREGWFQESSVASPTRFPGETSDGKYYHRSSQSQLHDLQYHNLYEPSRSETPHHSVY
SERSYVPAAAPHRSTYSEHSVGISKSDTSSEKSILRNKKRYVRERNPVVKRHILPSAGGAPFATCSYCLELLQLPQVSPQ
GKRQRYQVRCGSCSGVLKFSIREKADTVLDSPSFVDYGMDFADETVTNHQDSASEGHEEINPDGSHLTCLDDDSGETICK
SNDAVILSQKILETFEDKGIKEDIRNISTKFLDLKLEALQPHLKPMGNRRLSEQQPTSSETIGETSKIHLEQSQEAHSEK
STEMDNNICDIEEPEYEKNEIIKPEEIVGEGSGESLEVPVNQNERMSESSEEDERVAERSVSHSEELLYKKEYVSETRVQ
SENTGDTYEFEWEETQETEEYEGESTLEEIGDKPQLHLDKSRYTRDSICDSSLSYGEPFEDTSVKEDTEHISNTISDAKS
ATTHSPLNSLVNENQRFIGHLDQSGEATVTISRIQEHSKYEYENLSERQELEMTISDRVTCKLEESRYETNETLEPSKVG
EDGSLVSFEKVSEAFETIIEGKTGEERLVSHQMDSPNENVENSYGTLEPVYLEESGFAGERTWEGTIEDRAGLHLEEYES
NYENYSRPFEWTSETAPTFRMHDYELGTILEPDEYADGRSESSSRGSFNDDGGSEERVVFHESQVAIPEQSHYEYENSSK
RQELSDTVFDIARSELQEYRYERNETLEPSKMVGDGSVVPVEKAGETFISKKNEDSSVSHQMESQNEDMENSYGTKEPVY
PEGSRCESENSWAETMGDGAGLKLEEYNSNPFEWTSEKAAAFHLHEYERWTVPEPEEDANERSITSSRDSFNDHENLKGI
AVSHEEEPWLVDENRTEALKVGVMVEDEPSLHLTKFENETMKLEETLEWTSERAPTFRLPEYELGEMLESDNDVDERSEY
SSKGSFNDHEIPRELLNEEDPQLVIDGRTEAVQVGEMAKDTVSLHLEECGNESMKLDETFEWTSGRTLTFRRHGYEVETK
LEADEDADGRSESSSRGSFNDRGSSKERAVLHEDGSWLVDDYETKALKVGVMAEDGSSLQLEKGENGKMDLDETLEPRDD
IFRLSLDDTLEQERMTFHLKMSQDKQESLRQTFKQGDAEKDSDVFSEGHEFPSKMAELDSDTEEEIVEEQLEHLQKENEK
LSLTFEQHDHIYSTTEPSEIVGLRHALYQTQNSPLRSPLTSPIHTPIGSPLHYLMASQIRSPIASTMHSHIVSPLRSPIN
SSGSLSDVLFFSKKT*

DNA
ATGATGAAGAAGAAGAAACAGAGCAGATCCCAGTCTTCTTCTACCAAGAAAACTTTTGAACCATCCTCAGATTCTTCACC
TTCACCTAGGCTCCTCTCCATTATCCGTTCTAAGTTGGCAAGTAGTAAAGACTTGAAGCATATGTTCAGAGGTATGAGGA
GTAGAACCGTGCCCGGATTATCTTCTCAATCTAGAATCGTGAGATGTCCTAAGTGCCACAAACTTCTCCAGGAACCTTTA
GATGCTACTTCTTACAAATGTGGTGGATGCGACTCGATTCTTCATGCAAAACGTTGGGAACCTGACGGCAATGATCACAC
AAACACTATTCCTGAGGCTCTCCTTTCTTCTCAAAACCGTAGTTTAAGTGCTGAGGTAGAATCTCCAGAAGATGGTAGTA
GAACTCCAATGAGAACTACTCACCGGGAGTACAATTCAAGGCCATCGACTTCTGTTGAAAGAGGTTATCATCCAGAAACT
GTTTACAAGCCTGAGACATCTGATATCCGCAGAGAATGGATGAGAAGGACTGATGACTTCAGTGAGACCGGTGATTCTGA
TGTGTTTACTTCAGAAAGAAGCTCTCCATATAACACACGCAGCAATGCTGCGCAATGGGCACAACATGAGGGAAGATACG
CAGATCCACCTCGGGTTCCTTTCTATCCAGCAAGTCCTTCCCCTTCTTCTGCATATGAATATGGCTACAGTAGTCCTTTT
CACGGGTCTTACGTTTCTGCATCAGAGCAGTCTTATTATCATCAACAACCAAACCAATTCGAGCAGTATAGCAGAGAAGG
CTGGTTTCAAGAATCTTCTGTTGCTTCACCTACTCGTTTTCCGGGTGAGACATCTGATGGAAAGTACTATCACAGGTCTT
CTCAGTCTCAGCTACATGATCTTCAGTATCATAATCTTTATGAACCAAGTAGATCTGAAACCCCGCATCACTCTGTGTAC
TCTGAGCGTAGTTATGTACCAGCTGCTGCGCCACACCGCTCTACATACTCTGAGCATTCTGTAGGGATTTCTAAGAGTGA
CACAAGTAGTGAAAAGAGCATTCTAAGGAACAAAAAACGGTATGTCAGGGAAAGGAATCCGGTAGTGAAGCGCCATATTC
TCCCTTCAGCCGGCGGTGCACCTTTTGCAACTTGTTCCTATTGCTTGGAACTTCTACAGCTTCCTCAAGTGTCTCCCCAA
GGAAAACGTCAAAGATATCAAGTGAGATGTGGCAGTTGTTCCGGTGTACTTAAGTTCTCTATTCGAGAGAAAGCAGATAC
TGTCCTGGATTCACCTAGCTTTGTGGATTATGGCATGGATTTTGCAGATGAGACTGTTACTAATCACCAGGATTCAGCAT
CAGAAGGTCATGAAGAGATTAATCCTGATGGAAGTCATCTGACGTGTTTAGACGACGATTCTGGAGAAACAATCTGCAAA
AGTAACGATGCTGTTATATTGAGTCAAAAAATTCTAGAAACATTTGAGGATAAAGGGATTAAAGAAGACATAAGGAATAT
ATCCACCAAATTTTTAGATTTGAAATTGGAGGCATTACAGCCTCATCTAAAACCTATGGGGAACCGCAGATTAAGCGAGC
AACAACCTACATCAAGTGAGACTATTGGAGAGACTTCCAAGATTCATCTAGAGCAATCTCAGGAAGCTCATTCAGAAAAG
TCAACCGAGATGGATAATAACATTTGTGATATAGAAGAGCCTGAATATGAGAAGAACGAAATTATTAAGCCAGAAGAAAT
TGTAGGAGAAGGATCAGGTGAGTCCTTGGAAGTTCCAGTAAACCAGAACGAAAGGATGAGTGAATCAAGTGAAGAAGATG
AGAGAGTTGCAGAGAGATCGGTATCTCATAGTGAGGAACTTCTATACAAGAAAGAATACGTCAGTGAAACACGTGTACAG
TCTGAGAATACCGGAGACACTTACGAGTTTGAATGGGAGGAGACTCAAGAAACTGAAGAATATGAAGGTGAAAGTACATT
AGAAGAGATCGGAGACAAACCGCAGTTGCATTTGGATAAATCTAGGTACACTCGAGATTCTATATGTGACAGCAGCTTAA
GCTATGGTGAACCATTTGAGGATACATCAGTCAAGGAAGATACGGAGCACATATCAAACACAATTTCAGATGCGAAGTCA
GCTACAACACATTCTCCCTTGAACTCTTTGGTGAATGAGAATCAGAGGTTTATAGGACATCTTGACCAATCAGGCGAGGC
TACAGTAACAATATCCAGGATCCAGGAGCACTCCAAGTATGAATATGAGAATTTAAGCGAAAGACAAGAGTTGGAAATGA
CCATTAGTGACAGAGTCACGTGTAAGTTAGAGGAGTCTAGATACGAGACAAATGAAACTCTTGAGCCGAGCAAGGTGGGC
GAAGATGGATCTCTTGTTTCTTTCGAGAAGGTGAGCGAGGCATTCGAAACAATCATAGAAGGCAAGACAGGTGAAGAGAG
ACTGGTATCTCATCAAATGGATTCTCCAAACGAGAATGTAGAAAATTCTTATGGAACATTAGAACCGGTTTATCTAGAAG
AAAGCGGGTTTGCAGGTGAAAGAACATGGGAAGGGACAATAGAAGATAGAGCGGGGTTACATTTGGAGGAATATGAAAGC
AACTATGAGAATTACAGCAGACCATTTGAATGGACTTCAGAAACAGCTCCAACATTTCGCATGCATGATTATGAGCTAGG
GACAATACTTGAACCAGACGAGTATGCTGACGGAAGATCAGAATCAAGTTCACGGGGCTCCTTCAATGACGATGGAGGTT
CAGAAGAGAGGGTCGTTTTTCATGAGTCTCAAGTTGCTATACCTGAGCAGTCCCACTATGAGTATGAGAACTCAAGCAAA
AGACAAGAGTTGAGTGACACCGTTTTTGACATAGCAAGGTCTGAATTACAAGAGTATAGATATGAGAGAAATGAAACACT
TGAGCCAAGTAAGATGGTTGGAGATGGATCTGTTGTTCCTGTTGAGAAGGCGGGTGAAACTTTCATAAGCAAAAAGAATG
AAGACAGCTCGGTATCTCATCAAATGGAGTCTCAAAATGAAGATATGGAAAATTCCTACGGAACAAAAGAACCGGTTTAT
CCGGAAGGAAGCAGATGTGAAAGTGAAAATTCATGGGCAGAGACAATGGGAGATGGAGCGGGGTTGAAGTTAGAGGAATA
TAATAGCAATCCATTTGAATGGACTTCTGAAAAAGCTGCAGCATTTCATCTGCATGAGTATGAACGATGGACAGTGCCTG
AACCAGAAGAGGATGCTAATGAAAGATCAATAACCAGTTCACGGGATTCCTTTAATGACCATGAAAATTTAAAAGGGATA
GCTGTGTCTCATGAGGAGGAGCCCTGGCTAGTGGATGAGAACAGAACGGAAGCTCTAAAAGTTGGTGTAATGGTGGAAGA
TGAACCATCGCTGCACCTGACGAAATTTGAAAACGAAACAATGAAATTGGAAGAGACACTTGAATGGACTTCAGAAAGAG
CTCCAACATTTCGTCTACCTGAGTATGAGCTAGGGGAAATGCTTGAATCAGACAACGACGTTGATGAAAGATCAGAATAT
AGTTCAAAGGGTTCCTTCAATGATCATGAAATTCCAAGAGAGTTGTTAAATGAGGAGGATCCCCAGCTGGTGATTGATGG
CAGAACCGAAGCTGTACAAGTAGGCGAAATGGCAAAAGATACAGTATCACTGCACTTGGAGGAATGCGGAAATGAATCAA
TGAAACTGGATGAGACATTTGAATGGACGTCAGGGAGAACTTTAACGTTTCGTCGCCATGGGTATGAGGTAGAGACAAAG
CTTGAAGCAGACGAGGATGCTGATGGAAGATCAGAATCTAGTTCAAGGGGTTCCTTCAATGATCGTGGAAGTTCAAAAGA
GAGAGCTGTACTTCACGAGGATGGGTCTTGGCTGGTGGATGATTATGAAACCAAAGCGCTAAAAGTAGGCGTAATGGCAG
AAGATGGATCATCGCTGCAGTTGGAGAAAGGCGAAAATGGAAAAATGGATTTGGACGAGACACTTGAACCAAGGGATGAT
ATATTCAGGCTCAGTCTTGATGACACACTTGAGCAAGAAAGGATGACGTTTCATTTAAAGATGTCTCAAGATAAGCAAGA
AAGTCTAAGGCAGACCTTTAAACAAGGTGATGCTGAAAAAGATTCAGACGTATTTTCAGAAGGCCATGAATTTCCAAGTA
AAATGGCAGAACTAGATAGTGACACTGAAGAGGAGATAGTGGAAGAACAATTAGAACATTTGCAGAAAGAGAATGAGAAG
TTAAGTCTAACCTTTGAACAACATGATCACATCTACAGCACAACGGAGCCTTCTGAAATTGTGGGTTTGCGTCATGCGTT
ATACCAAACGCAAAATTCACCTCTACGATCACCTCTCACTTCACCAATTCATACTCCCATTGGTTCTCCGCTGCATTACC
TGATGGCTTCACAAATACGTTCTCCAATAGCTTCAACAATGCATAGTCACATAGTTTCACCGCTTCGTTCTCCCATCAAC
TCCTCTGGATCACTCTCTGATGTATTGTTCTTCAGCAAGAAAACTTGA