Details for Arabidopsis Locus AT3G56390

Position : Chr3 ( 5`- 20907354 .. 20907697 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56390

Protein [Map View]
MEEILMSMIFNGINLVKELEFSLSSQESPESDLSSSLSSISTLFGDVNERLKTLLAWRNSLSQYQPEPEPVLMLDMTN*

DNA
ATGGAGGAGATATTAATGTCAATGATATTCAACGGAATCAATCTGGTCAAGGAGCTTGAGTTCAGTTTATCATCACAAGA
GTCACCAGAATCAGATTTGTCGAGTTCTCTAAGCTCGATATCCACTCTATTCGGAGACGTCAACGAGCGGCTGAAAACCC
TACTAGCGTGGAGGAACTCTCTGTCACAGTACCAGCCTGAACCGGAACCGGTTTTAATGTTGGATATGACGAATTGA