Details for Arabidopsis Locus AT3G56370

Position : Chr3 ( 5`- 20899099 .. 20902981 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56370

Protein [Map View]
MYKALIFTVLLVSAVAPVRSLDPPLNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFS
LSGRIGRGLLQLQFLHKLSLSNNNLTGIINPNMLLSLVNLKVVDLSSNGLSGSLPDEFFRQCGSLRVLSLAKNKLTGKIP
VSISSCSSLAALNLSSNGFSGSMPLGIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCML
LKTIDLSENSLSGSLPNTFQQLSLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQVPDSIGNLLALKVLNFSG
NGLIGSLPVSTANCINLLALDLSGNSLTGKLPMWLFQDGSRDVSALKNDNSTGGIKKIQVLDLSHNAFSGEIGAGLGDLR
DLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHNQLNGMIPRETGGAVSLEELRLENNLLEGNIPSSIKNCSSLRSLILS
HNKLLGSIPPELAKLTRLEEVDLSFNELAGTLPKQLANLGYLHTFNISHNHLFGELPAGGIFNGLSPSSVSGNPGICGAV
VNKSCPAISPKPIVLNPNATFDPYNGEIVPPGAGHKRILLSISSLIAISAAAAIVVGVIAITVLNLRVRASTVSRSAVPL
TFSGGDDFSRSPTTDSNSGKLVMFSGEPDFSTGTHALLNKDCELGRGGFGAVYRTVIRDGYPVAIKKLTVSSLVKSQDEF
EREVKKLGKLRHSNLVKLEGYYWTTSLQLLIYEFLSGGSLYKQLHEAPGGNSSLSWNDRFNIILGTAKCLAYLHQSNIIH
YNIKSSNVLLDSSGEPKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPV
EYMEDDVVVLCDMVREALEDGRADECIDPRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVNILRMIRCPSGSSDE
LGSS*

DNA
ATGTACAAAGCACTGATTTTTACAGTCTTGTTGGTGTCGGCAGTAGCTCCGGTGAGATCTCTAGACCCGCCTTTAAACGA
CGACGTTTTAGGGCTCATTGTCTTCAAAGCCGATTTACGAGATCCAGAGCAAAAGCTAGCTTCTTGGAACGAAGATGACT
ACACTCCTTGTAGTTGGAACGGAGTCAAATGCCATCCGAGGACGAATCGAGTCACTGAGTTAAATCTAGATGGCTTCTCT
CTGTCTGGTCGAATTGGTCGTGGCCTACTTCAGCTTCAGTTTCTTCATAAGCTCTCTCTGTCCAACAACAATCTCACGGG
AATCATTAACCCTAATATGCTGCTGAGCCTTGTTAACCTTAAGGTTGTTGACTTGAGTAGCAATGGCTTGTCTGGTTCGC
TTCCTGATGAGTTTTTCAGGCAATGTGGGTCATTAAGAGTTTTATCTCTGGCGAAGAACAAACTAACGGGGAAGATTCCG
GTTAGTATAAGCTCGTGCTCGTCTCTTGCTGCTTTAAACTTGTCTTCCAATGGTTTTTCTGGTTCTATGCCTTTGGGGAT
TTGGTCTTTGAACACTCTAAGATCACTTGATTTGTCGAGGAATGAGTTAGAGGGAGAGTTTCCAGAGAAGATAGATAGAT
TGAACAACTTGCGTGCGCTTGATTTGAGTAGAAACCGGTTATCTGGTCCTATTCCTAGCGAAATTGGGAGCTGTATGCTG
CTGAAGACTATTGATCTTAGTGAAAACTCTCTATCAGGAAGCTTACCAAATACATTTCAGCAGCTCAGTTTGTGTTATTC
TCTGAACTTGGGAAAGAATGCGTTAGAAGGTGAAGTTCCAAAGTGGATAGGAGAAATGAGGAGTCTTGAGACTTTGGATC
TTTCCATGAATAAGTTTTCAGGGCAGGTTCCAGACTCCATAGGCAACCTTCTAGCACTGAAAGTTCTCAACTTTTCTGGG
AATGGGCTTATTGGTAGCTTGCCGGTCTCAACAGCCAACTGTATCAACCTCTTGGCCTTAGATTTAAGTGGGAATTCACT
AACTGGAAAGCTTCCCATGTGGCTATTTCAAGATGGTTCTCGTGATGTGTCTGCATTAAAGAATGATAACTCTACTGGAG
GTATCAAGAAGATCCAGGTTTTGGATCTCTCCCACAATGCATTCTCTGGCGAGATTGGAGCTGGTCTAGGAGATCTTAGA
GACCTGGAGGGATTGCATCTGTCCAGAAACTCTCTTACCGGCCCCATCCCCAGTACCATTGGGGAACTAAAGCACTTGAG
CGTCCTTGATGTGAGTCACAATCAGCTCAATGGAATGATTCCTCGAGAAACAGGTGGAGCTGTTTCTTTGGAGGAGTTGA
GACTTGAAAATAACTTGTTGGAGGGAAATATTCCATCTTCCATCAAGAATTGCAGTTCCCTTCGGTCTTTGATCCTGTCA
CATAACAAGCTGCTAGGCTCAATTCCACCAGAGCTCGCTAAACTTACAAGACTCGAAGAAGTCGACTTATCATTTAATGA
ACTGGCCGGAACACTTCCTAAACAGTTGGCTAATCTCGGCTATCTTCACACATTCAACATATCTCATAACCATCTCTTTG
GGGAACTACCTGCAGGTGGAATCTTCAACGGTTTATCCCCAAGTTCAGTATCAGGAAACCCGGGAATTTGCGGTGCTGTT
GTCAATAAGTCTTGTCCTGCCATCTCCCCTAAACCGATTGTGTTGAATCCTAATGCAACTTTCGATCCTTACAATGGTGA
AATAGTGCCTCCAGGTGCTGGTCACAAAAGGATACTGCTTAGTATATCTTCTTTGATAGCCATTAGTGCTGCTGCAGCCA
TTGTGGTTGGTGTAATAGCCATCACGGTACTTAATCTGAGAGTGCGCGCATCAACGGTTTCAAGATCAGCAGTACCGCTC
ACGTTCTCAGGCGGAGATGACTTCAGTCGATCTCCCACTACTGATAGCAACTCAGGGAAGCTGGTGATGTTCTCTGGTGA
ACCTGATTTCAGCACTGGAACACATGCTCTGCTTAACAAAGACTGTGAGCTTGGTCGAGGTGGATTTGGAGCGGTGTACA
GAACAGTTATCAGAGATGGGTATCCTGTAGCTATCAAGAAGCTCACTGTCTCGAGTCTTGTCAAGTCTCAGGACGAATTC
GAAAGAGAGGTGAAGAAACTTGGAAAACTCAGGCATTCGAATCTGGTTAAACTCGAAGGATATTACTGGACAACTTCTCT
CCAGCTTCTGATCTATGAGTTTCTCTCTGGTGGGAGTTTATACAAACAGTTGCACGAAGCACCAGGAGGTAATAGTTCGC
TTTCTTGGAATGATCGGTTCAACATTATCCTTGGTACAGCGAAATGCTTAGCTTACTTGCACCAATCAAACATCATCCAC
TACAACATCAAATCGAGCAACGTGTTGCTAGACAGCTCTGGTGAGCCTAAAGTAGGAGACTACGGATTAGCGAGGCTGTT
ACCTATGCTAGATAGGTACGTGCTGAGTAGCAAGATACAGAGTGCGTTGGGATACATGGCTCCAGAGTTTGCTTGTAGAA
CGGTGAAAATAACAGAGAAATGTGATGTTTATGGATTTGGAGTCTTGGTCCTTGAAGTGGTTACAGGTAAAAAGCCTGTG
GAGTATATGGAAGATGATGTTGTGGTTTTGTGTGATATGGTGAGAGAAGCTCTTGAAGATGGAAGAGCAGATGAATGTAT
TGACCCAAGGCTGCAAGGGAAGTTTCCGGTAGAAGAAGCGGTTGCAGTGATAAAGCTAGGGCTTATTTGCACTTCTCAGG
TTCCATCAAGTAGACCACATATGGGAGAAGCTGTTAACATATTGAGGATGATCAGATGCCCTTCAGGGAGCTCAGATGAG
TTGGGTTCAAGTTGA