Details for Arabidopsis Locus AT3G56350

Position : Chr3 ( 5`- 20893946 .. 20895625 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56350

Protein [Map View]
MTTTVIIIIFVAIFATTLHDARGATMEPCLESMKTASLPDLPYAYDALEPAISEEIMRLHHQKHHQTYVTQYNKALNSLR
SAMADGDHSSVVKLQSLIKFNGGGHVNHAIFWKNLAPVHEGGGKPPHDPLASAIDAHFGSLEGLIQKMNAEGAAVQGSGW
VWFGLDRELKRLVVETTANQDPLVTKGSHLVPLIGIDVWEHAYYPQYKNARAEYLKNIWTVINWKYAADVFEKHTRDLDI
N*

DNA
ATGACGACCACCGTTATTATCATTATCTTCGTTGCCATCTTCGCTACGACTCTTCACGACGCCAGAGGAGCAACCATGGA
ACCGTGTCTCGAATCAATGAAGACTGCTTCGCTTCCTGATCTTCCGTATGCTTATGATGCGCTAGAGCCAGCAATCAGTG
AGGAGATCATGCGGCTACACCATCAGAAACACCACCAGACTTATGTCACTCAGTACAACAAAGCCCTCAACAGCCTTCGT
TCTGCCATGGCTGACGGTGATCACTCCTCCGTCGTCAAACTCCAAAGCCTCATCAAGTTCAACGGCGGAGGGCACGTTAA
CCATGCAATCTTCTGGAAAAACCTAGCCCCGGTTCATGAAGGAGGTGGCAAACCACCGCATGATCCTTTGGCTTCGGCGA
TCGATGCTCATTTCGGATCACTAGAAGGATTGATCCAAAAAATGAACGCGGAAGGCGCTGCTGTACAGGGATCTGGATGG
GTGTGGTTTGGATTAGACAGAGAGCTTAAGAGACTTGTCGTTGAAACCACAGCCAACCAGGATCCATTGGTGACTAAGGG
ATCACACCTAGTTCCTCTAATTGGGATTGACGTGTGGGAGCATGCCTACTATCCACAGTACAAGAATGCAAGAGCGGAGT
ACTTGAAGAACATATGGACTGTAATCAACTGGAAATATGCAGCGGACGTCTTCGAGAAGCACACTCGTGATCTTGATATT
AACTGA