Details for Arabidopsis Locus AT3G56300

Position : Chr3 ( 5`- 20880169 .. 20882366 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56300

Protein [Map View]
MSEMEVEKPDLTLYNTMTQLKEVYKPMNPGKIGIYVCGITAYDYSHIGHARAAVSFDLLYRYLRHLGYQVTYVRNFTDVD
DKAKNCGEKPLDLSNRFCEEYLLDMAALQCLLPTHQPRVSDHMEQIIKMIEKIIENGCGYAVGGDVFFSVDKSPSYGQLS
GQRLDHTQAGKRVAVDSRKRNPADFALRKAAKSGEPSWESPWGHGRPGWHIEFDIHGGGADLKFPHHENEIAQTCAACED
SGVNYWLHNGHVTNNNVKMGKSLNNFFTIRQIAANYHPLALRHFLMSAQYRSPLNYSVSQLESSSDALYSLSPYREEMSG
DVGKTQQSAEAKEMIKKVKNALKFINVSISKLKKMQKKQRMSLVVSLVEVEKAVREVLDVLGLLTTLSYGELLKDMKQKA
LTRAGMGEEEVLQRIEERNMARKSKDFRRSDRIRELLAFKGIFLEDVPGDTVWRPSTPLTKPKSGLGLGMTAIVFAIVFT
FLGFFFYSR*

DNA
ATGTCGGAGATGGAGGTGGAGAAACCGGATTTGACATTGTACAACACAATGACTCAACTGAAGGAAGTTTATAAGCCGAT
GAATCCCGGCAAAATCGGAATCTATGTATGCGGTATCACCGCTTACGATTATAGCCACATTGGCCACGCTCGTGCCGCCG
TGTCCTTCGACCTCCTTTACAGATACTTAAGGCACTTGGGTTATCAAGTTACTTATGTCAGAAATTTTACAGATGTTGAT
GACAAGGCTAAAAACTGTGGAGAGAAGCCGTTAGATTTGAGTAATCGCTTTTGCGAGGAGTATCTTTTAGATATGGCTGC
TCTTCAGTGCCTCCTTCCCACCCACCAGCCTCGTGTCAGTGATCATATGGAACAGATCATTAAGATGATAGAAAAGATCA
TTGAGAATGGATGTGGGTATGCTGTGGGTGGTGATGTGTTCTTCTCAGTGGACAAATCACCGAGTTATGGTCAGTTATCT
GGTCAACGGCTGGATCATACTCAAGCTGGTAAGCGTGTTGCTGTTGACTCAAGGAAGCGTAATCCTGCTGACTTTGCATT
ACGGAAGGCTGCAAAATCTGGTGAACCAAGTTGGGAGAGCCCTTGGGGTCATGGAAGACCAGGATGGCACATCGAGTTTG
ACATTCATGGTGGTGGCGCAGATCTCAAATTCCCGCACCATGAAAATGAGATCGCCCAGACATGTGCTGCTTGTGAAGAT
AGTGGTGTGAACTACTGGTTGCATAACGGGCATGTCACCAACAACAATGTGAAGATGGGAAAATCATTGAACAACTTTTT
TACGATTAGACAAATCGCGGCTAACTATCATCCACTGGCTTTGAGACATTTCTTGATGAGTGCACAGTACCGTTCTCCTC
TCAACTATTCGGTTTCGCAGCTTGAGAGTTCATCGGATGCTTTATACTCTCTATCGCCATATCGAGAAGAAATGAGTGGA
GATGTTGGAAAGACTCAACAGTCTGCAGAAGCCAAAGAGATGATAAAGAAGGTGAAAAACGCATTGAAATTCATCAACGT
TTCAATCTCCAAGCTCAAGAAAATGCAGAAGAAGCAGCGGATGTCGCTGGTAGTGTCACTGGTCGAGGTTGAGAAGGCAG
TGAGGGAAGTTCTTGATGTGCTTGGTTTGCTCACGACTCTAAGCTACGGTGAGCTTTTGAAAGACATGAAACAAAAGGCA
TTAACAAGAGCAGGAATGGGAGAAGAAGAGGTCTTGCAGAGGATTGAAGAAAGGAATATGGCCCGGAAGAGCAAAGATTT
CAGGAGAAGCGATCGGATTCGAGAGCTGTTGGCATTTAAAGGAATCTTCCTCGAGGATGTTCCTGGAGACACTGTGTGGA
GACCTTCCACCCCATTGACCAAGCCTAAATCTGGTTTAGGTTTAGGCATGACAGCCATCGTTTTTGCTATCGTTTTTACT
TTCTTAGGCTTCTTCTTCTATAGCCGTTGA