Details for Arabidopsis Locus AT3G56290

Position : Chr3 ( 5`- 20878539 .. 20879568 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56290

Protein [Map View]
MGFRALPLQHSSGFISTTKVSISRTSPRIFRNPRWVVVSAKQEKDEDKKKNEEETSLFTQLTDALDFSQVRSEKDAELLY
EAREATKSGRKMTQEQYGALRRKIGGTYKDFFKSYVEVDGQYVEEGWVDKTCKICKKDTKGEARQVDKLGRYAHVSCLQN
PPSGNFFTRLFSR*

DNA
ATGGGTTTTAGAGCACTGCCTCTTCAACACAGCAGTGGGTTCATCTCCACGACCAAAGTATCCATCTCAAGAACCTCGCC
CAGGATTTTCCGGAACCCTAGATGGGTCGTTGTCTCAGCAAAGCAAGAGAAAGATGAGGATAAGAAGAAGAATGAAGAGG
AGACTTCGTTGTTTACTCAATTAACGGATGCCTTGGACTTCTCACAAGTTCGATCGGAGAAAGACGCTGAGCTTCTCTAC
GAGGCTCGAGAAGCCACCAAATCTGGTCGCAAGATGACCCAAGAACAGTATGGGGCATTGAGGAGAAAAATCGGAGGAAC
ATACAAGGACTTTTTTAAATCCTACGTTGAAGTGGATGGGCAATATGTGGAGGAGGGATGGGTGGACAAAACATGTAAGA
TATGCAAAAAGGACACAAAGGGTGAGGCAAGACAAGTGGACAAGTTAGGGAGATATGCTCATGTCTCTTGTCTTCAAAAT
CCTCCCTCTGGAAATTTCTTCACCAGACTCTTCTCTAGATGA