Details for Arabidopsis Locus AT3G56180

Position : Chr3 ( 5`- 20844667 .. 20845692 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56180

Protein [Map View]
MPKNKKTEWQVGDPAISVVSDQFCNPYPMDLLVKRKVQNFSKDYYEVFDPSGNLLLQIDGQAWGFNRKRVMRDPAGFTIL
SMRQKGLALKNKWEVHGGESKEREDLLFTVQQSQAVSLKTSVDVFLPENNNVKKTNTCDFHASGGYSNISFKVFKADALI
AGVGFTWGSFCKGKYNFKVRVNPEVDYAFIIALLVMVDDNENWC*

DNA
ATGCCGAAGAATAAAAAAACAGAATGGCAAGTAGGAGATCCCGCGATAAGCGTAGTGAGCGATCAATTCTGTAATCCATA
CCCAATGGATCTTTTGGTGAAGAGAAAAGTTCAGAATTTTTCTAAAGATTATTATGAAGTGTTTGATCCAAGTGGGAATC
TGCTCCTACAAATTGATGGACAAGCTTGGGGGTTTAACCGTAAAAGAGTTATGCGTGATCCAGCCGGTTTCACAATCCTC
TCAATGCGTCAAAAGGGACTTGCGTTGAAGAACAAGTGGGAAGTGCATGGAGGAGAGAGCAAAGAGAGAGAAGACTTGCT
CTTCACGGTACAACAATCTCAAGCGGTTTCACTGAAAACATCCGTGGATGTTTTCTTGCCGGAGAACAACAATGTCAAGA
AGACAAACACTTGTGATTTTCATGCTTCAGGAGGATACTCCAATATCTCATTCAAAGTTTTCAAAGCGGATGCTCTCATC
GCCGGGGTAGGGTTTACATGGGGAAGTTTCTGCAAAGGGAAATATAACTTTAAGGTGAGAGTAAATCCAGAGGTTGATTA
TGCTTTTATCATTGCTTTGCTTGTCATGGTCGATGACAACGAGAATTGGTGTTAG