Details for Arabidopsis Locus AT3G56170

Position : Chr3 ( 5`- 20842145 .. 20844476 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56170

Protein [Map View]
MGNAIRLLRKCLNSHGVSASSGGVSALSRDLLNFETTSQVPEKLGSYVVSSQKAQANWYRKILEAWKQAKPRPKTPEEAS
RLVIAALKNHQKADVEGLLSFYGLPSPHNLVEVPTEAPVSLPKGVRFELNTLPVDTKSVADGDTVTVYVSSKDPLVSSSL
PKDVSLAAVKRAKAREKKNYTEADALHKTIIASGYRMISFQNEEVLAKKFRIRLSGIDSPESKMPYGKEAHDELLKMVEG
KCLKVLVYTEDRYGRCVGDIYCNGKFVQEVMLKKGLAWHYVAYDKRAELAKWENEARQKRVGLWASSNPEKPWEWRKNKR
GGN*

DNA
ATGGGTAACGCGATTAGGTTACTCCGGAAATGCTTGAATTCTCACGGCGTCTCCGCCTCTTCCGGCGGCGTCTCAGCTCT
TTCTCGTGATCTCTTAAACTTCGAGACCACTTCTCAGGTTCCTGAGAAGCTTGGGAGTTACGTTGTGTCTTCCCAAAAGG
CTCAAGCAAACTGGTATAGAAAAATACTTGAGGCATGGAAGCAAGCTAAGCCTCGGCCTAAAACTCCTGAGGAAGCCTCC
AGGCTTGTTATCGCGGCTCTAAAGAACCATCAAAAAGCAGATGTTGAGGGACTTTTGTCTTTCTATGGACTACCTTCACC
TCACAATCTCGTTGAGGTCCCTACGGAAGCTCCTGTGTCTTTACCTAAAGGAGTTCGGTTTGAGCTTAACACGCTTCCGG
TGGATACAAAATCTGTGGCAGATGGTGATACTGTTACTGTGTATGTTAGTAGCAAAGACCCGCTTGTGTCATCTTCTCTT
CCTAAGGACGTGAGTCTTGCAGCGGTTAAAAGAGCCAAAGCGCGTGAGAAGAAGAATTATACTGAAGCAGATGCACTTCA
CAAGACGATCATAGCTTCTGGTTACAGGATGATAAGTTTTCAGAATGAGGAAGTGCTTGCTAAAAAGTTCAGAATTAGAC
TAAGCGGAATAGATTCACCGGAGAGCAAAATGCCGTATGGAAAAGAGGCGCATGATGAGCTACTCAAGATGGTTGAAGGG
AAATGCTTGAAGGTGTTAGTATATACAGAGGATCGTTATGGAAGATGTGTAGGAGATATATACTGCAATGGAAAATTTGT
ACAGGAAGTAATGCTAAAGAAAGGTCTTGCTTGGCATTATGTAGCCTATGACAAGCGTGCAGAGCTCGCAAAGTGGGAAA
ATGAGGCTAGGCAAAAGCGCGTTGGCTTGTGGGCATCTTCTAATCCAGAGAAGCCATGGGAGTGGAGAAAGAACAAACGT
GGAGGCAATTAA