Details for Arabidopsis Locus AT3G56150

Position : Chr3 ( 5`- 20833579 .. 20837160 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56150

Protein [Map View]
MTSRFFTQVGSESEDESDYEVEVNEVQNDDVNNRYLQSGSEDDDDTDTKRVVKPAKDKRFEEMTYTVDQMKNAMKINDWV
SLQENFDKVNKQLEKVMRITEAVKPPTLYIKTLVMLEDFLNEALANKEAKKKMSTSNSKALNSMKQKLKKNNKLYEDDIN
KYREAPEVEEEKQPEDDDDDDDDDDEVEDDDDSSIDGPTVDPGSDVDEPTDNLTWEKMLSKKDKLLEKLMNKDPKEITWD
WVNKKFKEIVAARGKKGTARFELVDQLTHLTKIAKTPAQKLEILFSVISAQFDVNPGLSGHMPINVWKKCVLNMLTILDI
LVKYSNIVVDDTVEPDENETSKPTDYDGKIRVWGNLVAFLERVDTEFFKSLQCIDPHTREYVERLRDEPMFLALAQNIQD
YFERMGDFKAAAKVALRRVEAIYYKPQEVYDAMRKLAELVEEEEETEEAKEESGPPTSFIVVPEVVPRKPTFPESSRAMM
DILVSLIYRNGDERTKARAMLCDINHHALMDNFVTARDLLLMSHLQDNIQHMDISTQILFNRTMAQLGLCAFRAGMITES
HSCLSELYSGQRVRELLAQGVSQSRYHEKTPEQERMERRRQMPYHMHLNLELLEAVHLICAMLLEVPNMAANSHDAKRRV
ISKNFRRLLEISERQAFTAPPENVRDHVMAATRALTKGDFQKAFEVLNSLEVWRLLKNRDSILDMVKDRIKEEALRTYLF
TYSSSYESLSLDQLAKMFDVSEPQVHSIVSKMMINEELHASWDQPTRCIVFHEVQHSRLQSLAFQLTEKLSILAESNERA
MESRTGGGGLDLSSRRRDNNQDYAGAASGGGGYWQDKANYGQGRQGNRSGYGGGRSSGQNGQWSGQNRGGGYAGRVGSGN
RGMQMDGSSRMVSLNRGVRT*

DNA
ATGACGTCTCGTTTTTTCACTCAGGTTGGAAGTGAAAGTGAAGATGAAAGTGATTATGAGGTAGAGGTTAATGAGGTTCA
GAATGATGACGTCAATAACCGTTACCTTCAAAGTGGTAGTGAGGATGATGATGATACTGATACGAAACGTGTGGTTAAGC
CTGCTAAGGATAAACGTTTTGAGGAGATGACCTACACTGTTGATCAGATGAAGAATGCTATGAAGATCAATGATTGGGTC
AGCCTTCAAGAAAACTTTGATAAGGTTAACAAACAGCTTGAGAAGGTTATGAGGATTACTGAGGCTGTGAAGCCTCCTAC
CTTGTATATCAAGACGCTTGTTATGTTGGAGGATTTCTTGAATGAAGCTCTTGCCAATAAGGAAGCCAAGAAGAAGATGA
GTACTAGTAACTCCAAGGCTTTGAACTCAATGAAACAGAAATTGAAGAAGAACAATAAGTTGTACGAAGACGATATCAAC
AAGTATCGTGAGGCTCCAGAAGTTGAGGAAGAGAAACAACCTGAAGATGATGATGATGATGACGATGATGATGATGAGGT
TGAAGATGATGATGATTCTTCCATCGACGGACCTACCGTAGATCCTGGGTCCGATGTGGATGAACCTACTGATAATCTCA
CTTGGGAGAAGATGCTGAGCAAAAAAGATAAGCTTTTGGAGAAGCTAATGAATAAAGATCCTAAAGAGATCACTTGGGAC
TGGGTCAACAAGAAGTTCAAGGAAATTGTGGCTGCTCGTGGAAAAAAGGGCACTGCTCGATTTGAGCTAGTTGATCAGCT
TACGCACTTGACAAAGATTGCCAAGACTCCTGCACAGAAGCTTGAAATCTTGTTTAGCGTTATTTCGGCTCAGTTTGATG
TGAATCCAGGTCTCAGCGGGCACATGCCTATCAATGTCTGGAAGAAATGCGTGCTTAACATGCTCACCATACTGGACATT
CTCGTCAAGTACAGTAACATTGTTGTGGATGACACAGTTGAGCCTGATGAGAACGAAACTTCAAAGCCAACAGATTATGA
TGGAAAAATTCGGGTCTGGGGAAATTTGGTTGCATTCTTGGAGAGGGTTGACACTGAGTTTTTCAAGAGTTTGCAATGCA
TTGATCCTCACACCCGTGAGTATGTTGAGAGGCTAAGGGATGAGCCCATGTTCTTGGCCCTTGCTCAGAACATCCAGGAC
TACTTTGAGCGGATGGGTGATTTTAAAGCTGCTGCAAAGGTAGCCTTAAGACGTGTTGAGGCAATATACTACAAGCCCCA
GGAAGTTTATGATGCAATGAGGAAATTGGCTGAGTTGGTGGAAGAAGAAGAAGAAACTGAGGAGGCCAAAGAGGAAAGTG
GACCTCCTACTTCATTTATTGTTGTTCCGGAGGTTGTTCCCCGTAAGCCTACCTTCCCAGAGAGCAGCCGAGCTATGATG
GATATTCTTGTGTCCCTTATCTACAGAAATGGAGATGAGCGGACCAAAGCGCGTGCGATGCTATGTGATATCAATCACCA
TGCTTTAATGGACAACTTTGTGACTGCTAGAGACCTGTTGCTGATGAGTCATCTGCAAGACAACATCCAGCACATGGACA
TCTCAACACAGATTCTCTTTAACAGGACCATGGCGCAGCTTGGTCTTTGCGCCTTCCGGGCTGGAATGATCACTGAGTCC
CATAGCTGCCTTTCCGAGCTGTACTCTGGTCAAAGAGTGAGAGAGTTGCTTGCCCAAGGTGTCTCGCAAAGCCGATACCA
TGAGAAAACCCCGGAGCAGGAAAGGATGGAAAGGAGAAGACAAATGCCGTACCACATGCACTTAAACCTTGAGCTTCTGG
AGGCAGTTCATCTCATCTGTGCCATGCTTCTTGAAGTCCCAAACATGGCTGCAAACTCGCACGATGCCAAACGCAGAGTG
ATTAGCAAGAATTTCCGCCGCCTGCTCGAGATCAGTGAAAGGCAAGCATTCACTGCACCGCCTGAGAATGTACGTGACCA
TGTCATGGCAGCCACCAGAGCCCTGACCAAAGGAGATTTCCAGAAGGCGTTTGAAGTTTTGAACTCTCTTGAGGTCTGGA
GGCTGCTCAAGAACCGTGACAGCATCCTTGACATGGTGAAGGATAGGATCAAAGAAGAGGCTCTAAGGACTTACCTATTC
ACATACTCAAGCTCTTATGAGTCCTTGAGTCTTGATCAGCTGGCCAAAATGTTTGACGTCTCTGAGCCGCAGGTCCACAG
CATTGTGAGTAAGATGATGATTAATGAGGAACTGCATGCAAGCTGGGATCAGCCAACACGATGCATCGTCTTCCATGAAG
TGCAACACAGCAGATTACAATCATTGGCTTTCCAGTTAACGGAGAAACTCTCGATTTTGGCAGAAAGCAATGAGAGGGCA
ATGGAATCTAGAACCGGTGGAGGTGGTCTGGATCTGAGTTCAAGGAGAAGGGACAACAATCAGGACTATGCAGGAGCAGC
ATCAGGTGGTGGTGGATATTGGCAAGACAAGGCGAATTACGGACAAGGAAGACAAGGCAACAGATCAGGTTATGGTGGAG
GAAGATCATCTGGACAAAATGGTCAGTGGTCAGGGCAGAACCGAGGAGGAGGGTATGCAGGAAGAGTTGGTTCAGGAAAC
AGAGGTATGCAGATGGATGGCTCAAGCCGTATGGTGAGTCTTAACCGAGGTGTTCGTACTTAA