Details for Arabidopsis Locus AT3G56140

Position : Chr3 ( 5`- 20829282 .. 20832871 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56140

Protein [Map View]
MKLTTNDLFASQPLFHCPCSSSSRPRRRRFYGLHFPINLTSEKNNSLSIVALSDSDLPSRTAFSRRAFLLAPPLLVSAAS
LFLKPSVSLASEESSSATVTSPAESAAPPPPPATTTPSPPPPVNKEETITSRIYDATAIGEPMAMGKDKKKVWEKLLNAR
VVYLGEAEQVPTKDDKELELEIVRNLRKRCVESERQISVALEAFPLDLQDQLNQYMDKRMDGETLKSYVTHWPAQRWQEY
EPLLSYCRDNSVRLIACGTPLKVLRTVQAEGIRGLSKSERKLYTPPAGSGFISGFSSFSRRSTFDMSLPTQIVPFGPSSY
LSAQARVVEDHTMSQVILQAVADGGGTGLLLVVTGASHVEYGSRGTGLPARISRKFPKKNQVVVLLDPERQFLRREGETP
VADFLWYSAARPCSRNCFDRAEIARVMNAAGRRRDALPPDIQNGLDLGLVSPEVLQNLFDLEQYPLISELTQRFQGFRER
LLADPKFLNRLAIEEAISITTTLIAQYEKRKENFFEEIDYVITDTVRGSVVDFFTVWLPAPTLSFLSYADETTGPDSIDA
LRGLLGSIPDNAFQKSLAGREWNLNLRIASVIVGGLKLAGVGVVSSFAAVGASNALNIARKVIKPELVVAEKPKRSPLLK
TAMVYGGFLGTSANLRYQIIAGLIEHRLSDELSSQPLLVNAISFVVRTLNSYFGTQQWIDLARSTGLQTQKSIPASKEIS
EALEEPTVECDTTTEEESIDKLNNQ*

DNA
ATGAAACTCACCACGAATGATCTCTTCGCTTCTCAACCATTATTTCACTGCCCTTGCTCCTCCTCCTCCCGTCCTCGCCG
CCGACGTTTCTATGGCCTTCATTTTCCGATCAACCTCACCAGCGAGAAGAACAATTCTCTATCCATTGTTGCTCTTTCTG
ATTCCGATCTTCCATCACGAACCGCCTTCTCTCGCCGCGCTTTTCTACTCGCGCCACCACTTCTAGTCTCGGCTGCTTCC
TTGTTTCTCAAACCGTCTGTCTCTTTAGCCTCCGAGGAGAGCTCGTCCGCTACAGTAACATCGCCTGCGGAATCAGCAGC
TCCTCCTCCTCCTCCTGCGACCACAACACCGTCGCCGCCTCCACCCGTGAATAAGGAAGAGACGATAACCTCGAGAATCT
ATGACGCGACGGCCATTGGTGAGCCGATGGCTATGGGAAAAGATAAGAAGAAGGTGTGGGAGAAGCTGTTGAACGCGAGA
GTTGTGTACCTCGGTGAGGCGGAGCAAGTGCCTACCAAAGACGACAAAGAGCTTGAACTCGAAATCGTTAGAAACCTGAG
GAAGAGATGCGTTGAGAGCGAGCGTCAAATCTCTGTAGCACTGGAAGCATTCCCTCTCGATTTGCAGGATCAGCTTAATC
AATACATGGATAAGAGGATGGACGGAGAGACATTGAAGTCTTATGTGACACATTGGCCTGCTCAACGTTGGCAAGAATAT
GAGCCTCTTTTAAGTTATTGCCGCGATAACTCTGTTAGACTAATTGCTTGTGGCACTCCTCTCAAGGTTTTAAGAACTGT
CCAAGCAGAAGGTATCCGTGGTCTTTCAAAATCTGAGCGTAAATTATACACTCCCCCTGCTGGTTCTGGGTTTATCTCAG
GATTTTCTTCATTCTCACGTAGATCTACATTCGATATGAGTCTCCCAACACAGATTGTTCCTTTTGGACCGAGTTCATAT
TTGTCGGCACAAGCAAGAGTTGTTGAAGACCATACAATGTCACAAGTTATTTTACAAGCAGTAGCAGATGGAGGGGGTAC
TGGTCTACTGTTAGTGGTGACAGGGGCAAGTCATGTTGAGTATGGTTCAAGAGGAACAGGTTTGCCAGCAAGGATCTCAA
GGAAGTTTCCAAAGAAAAACCAAGTTGTTGTATTACTTGACCCTGAAAGACAGTTCTTGCGAAGAGAGGGCGAAACTCCA
GTTGCTGATTTCTTGTGGTATTCTGCTGCAAGACCCTGCAGTAGAAACTGCTTTGACCGAGCAGAGATTGCTCGAGTAAT
GAATGCAGCTGGCAGGAGGCGAGATGCCCTTCCTCCCGATATTCAAAATGGATTAGACCTTGGTCTGGTGTCACCTGAGG
TTCTGCAGAATCTCTTTGATTTGGAGCAGTATCCTCTTATTTCTGAGCTTACTCAGCGGTTTCAGGGTTTCCGAGAAAGG
TTGTTGGCAGATCCAAAATTCCTGAATAGGTTAGCCATCGAAGAAGCTATATCAATAACAACTACACTAATAGCACAATA
TGAGAAGCGAAAAGAGAATTTCTTTGAAGAAATTGACTATGTTATAACTGATACAGTGAGAGGATCAGTCGTTGATTTTT
TCACAGTTTGGCTTCCTGCACCAACTTTGTCTTTTCTTTCATATGCTGATGAGACCACTGGACCAGACAGCATAGACGCC
CTGAGAGGCCTCCTAGGATCCATACCTGATAACGCATTTCAAAAAAGTCTTGCTGGAAGAGAGTGGAACCTGAATCTTAG
AATTGCTTCAGTTATTGTTGGTGGCTTGAAGCTTGCTGGTGTTGGAGTTGTTTCCAGTTTTGCAGCTGTGGGAGCTTCAA
ATGCATTGAATATAGCACGAAAGGTCATTAAACCCGAGCTGGTTGTGGCTGAGAAACCTAAGAGGTCTCCTCTTCTGAAG
ACGGCAATGGTTTACGGAGGTTTTCTGGGAACATCTGCAAATCTTCGTTACCAGATAATTGCGGGATTAATAGAGCATCG
CCTATCTGATGAGCTTTCTTCGCAACCTCTACTTGTAAATGCTATTTCATTTGTTGTCAGGACCCTAAACTCATATTTCG
GAACGCAGCAATGGATCGATCTTGCACGCTCTACGGGTCTGCAAACTCAGAAAAGCATCCCAGCCTCTAAAGAAATTTCA
GAGGCTTTGGAAGAACCGACAGTGGAATGCGATACTACTACTGAAGAGGAAAGTATCGATAAGCTCAATAATCAATGA