Details for Arabidopsis Locus AT3G56090

Position : Chr3 ( 5`- 20814047 .. 20816035 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56090

Protein [Map View]
MLLKAASTFSLLNIHGEKKDISPLFSSSSSISSPVSSGKSGNLSFPLRASKSSTTTTSTLSGVVFEPFEEVKKEMDLVPS
GQQLSLARHLYSPECEAAVNEQINVEYNVSYVYHALYAYFDRDNVALKGLAKFFKESSVEEREHAELLMEYQNKRGGRVK
LQPMVLPQSEFDHPEKGDALYAMELALSLEKLVNEKLLNLHSVASKNDDVQLADFIESVFLNEQVEAIKKISEYVSQLRR
LGKGHGTWHFDQELLGAAA*

DNA
ATGCTTCTCAAAGCTGCTTCTACTTTCTCTCTATTGAACATTCATGGAGAGAAGAAAGACATCTCTCCTCTCTTCTCCTC
CTCCTCCTCCATTTCGTCTCCGGTTTCTTCTGGAAAATCCGGCAATCTCTCTTTCCCTCTTCGTGCTTCCAAGAGTTCAA
CCACTACCACAAGCACGTTGAGCGGCGTTGTGTTCGAGCCTTTCGAAGAGGTTAAGAAAGAGATGGATCTAGTTCCATCT
GGTCAACAGCTTTCTCTTGCTCGTCATTTGTACTCCCCTGAGTGCGAAGCCGCCGTCAATGAGCAGATCAATGTTGAGTA
TAACGTGTCGTATGTGTATCACGCTTTGTATGCATATTTCGATCGTGACAACGTTGCCCTCAAGGGTCTCGCCAAGTTTT
TCAAGGAATCGAGTGTGGAAGAACGAGAGCACGCTGAGCTGTTGATGGAGTATCAGAACAAACGTGGTGGGAGGGTCAAG
TTACAGCCCATGGTGTTGCCTCAGTCTGAGTTTGATCATCCTGAGAAAGGAGATGCTCTCTATGCTATGGAGTTGGCTCT
TTCATTGGAGAAACTAGTCAATGAAAAGCTCCTAAACCTGCACAGTGTGGCTTCCAAGAACGATGATGTCCAGTTGGCAG
ATTTTATTGAGAGTGTGTTTCTGAACGAACAGGTGGAAGCCATTAAGAAAATCTCAGAATATGTTTCTCAACTTAGGAGA
CTTGGCAAAGGACATGGAACATGGCATTTCGATCAGGAGCTTCTTGGTGCTGCTGCTTAA