Details for Arabidopsis Locus AT3G56040

Position : Chr3 ( 5`- 20792477 .. 20797572 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56040

Protein [Map View]
MANPQASPILHHPQNHLSLFHFRTTTSPRSFSSLHFRKPLLFLSSSSSFSSKLQQSEQQCNNHQVRHVSTVPVEYSTPTP
PESDDFLSEIDRLKSLLSKLDVSKDLRRKDAVIDADSRVRRFFSENRGGLSKVFGYLGLNSNEMFLVKCVIAAGQEHALC
MNYEEAFGEEEEEYTVRSSVKNALYALVEMIERFDVNSSGYKGRREMGTVLDSEEIAHFRKFLTFLEEIEQFYDCIGGII
GYQVMVLELLHQSSKRRNTNRSQLVEESLGCQYLEMHTPSVLDLTQEEDYASQAALWGIEGLPDLGEIYPLGGAADRLGL
IDSETGECLPAAMLAHCGRTLLEGLIRDLQAREFLYFKLYGKQCVTPVAIMTSAAKNNHEHVSSLCERLKWFGRGQSNFR
LFEQPLVPAVSAEDGQWIVSKPFVPVSKPGGHGVIWKLAYDKGVFNWFYDHGRKGATVRQVSNVVAATDVTLLALAGIGL
RYNKKLGFASCKRNAGATEGINVLMEKKNFDGKWEYGISCIEYTEFDKFDISNRSPSSNGLQADFPANTNILYVDLHSAE
LIGSSSNAKSLPNMVLNTKKRIEYLDQYGDYHSVMGGRLECTMQNIADNFFNKFPSRCHGSLEDKLDTYIVYNERRKVTS
SAKKKKPHASAALHQTPDGALLDILRNGYDLLTECDIKLPMIEANDKYVDSPPPYLILLHPALGPLWEVSRQKFKGGSIS
SCSELQLEIAEFSWNNVQVDGSLIVTAENAMGSTTPNDNGEPILQYGLRCGKCKLHNVNVVNRGIDWNSKSNVYWRNDVN
RLETCKIILHGNAEFEASNVTIEGHHVFEVPDGHKLKITSGNAGLSINLEALKEEVMETGSWYWNYQLNGSHIHLQQVEV
SQS*

DNA
ATGGCTAATCCTCAAGCTTCTCCAATTCTCCATCACCCCCAAAATCACCTCTCTCTCTTCCACTTTCGCACTACAACATC
TCCTCGCTCCTTCAGCTCTCTGCATTTCAGAAAACCACTCCTCTTTCTCTCTTCTTCTTCGTCATTTTCCTCGAAATTAC
AGCAGAGCGAGCAGCAATGTAATAATCACCAGGTGAGACACGTGTCCACCGTACCTGTCGAGTATTCTACACCGACTCCT
CCGGAATCCGACGATTTCTTATCGGAAATCGATCGGCTTAAGTCTCTCCTATCGAAACTAGACGTTTCCAAGGATTTACG
AAGGAAGGACGCGGTTATCGACGCTGATTCCAGAGTTCGTCGATTCTTCAGCGAGAATCGAGGCGGTTTATCTAAGGTTT
TTGGTTATCTTGGTTTGAATTCGAATGAGATGTTTCTCGTTAAGTGTGTTATCGCGGCGGGGCAAGAACACGCTCTATGT
ATGAATTATGAGGAAGCATTTGGAGAAGAAGAGGAGGAGTATACAGTGAGAAGCTCAGTGAAGAACGCACTTTACGCATT
GGTGGAGATGATTGAGAGATTCGATGTGAATAGTAGCGGCTATAAAGGTAGAAGAGAGATGGGTACAGTTTTAGATTCAG
AGGAGATTGCTCATTTTAGAAAATTCTTGACGTTTCTGGAAGAAATTGAACAGTTCTACGACTGCATTGGAGGAATCATT
GGATATCAGGTTATGGTTCTTGAGCTTCTTCATCAGTCATCTAAGAGACGTAATACTAACCGGTCACAACTTGTTGAAGA
ATCATTGGGTTGCCAGTATTTAGAAATGCATACTCCTAGTGTTCTTGATCTCACTCAGGAGGAAGATTATGCTTCACAGG
CGGCTCTGTGGGGAATTGAGGGATTGCCAGACCTAGGTGAAATATATCCCCTAGGAGGTGCTGCAGACAGACTAGGTTTG
ATTGATTCAGAAACTGGAGAATGCCTTCCTGCAGCAATGCTTGCTCATTGTGGACGAACTTTGTTGGAGGGACTTATTAG
AGATCTTCAGGCTAGAGAGTTCCTTTACTTCAAACTTTATGGAAAGCAATGTGTCACACCTGTTGCCATTATGACAAGTG
CTGCAAAGAACAACCATGAGCATGTAAGTTCGCTTTGTGAAAGGCTTAAATGGTTTGGCAGAGGTCAATCAAATTTCCGA
CTCTTTGAACAGCCTCTCGTCCCAGCTGTCAGTGCTGAAGATGGTCAATGGATAGTATCAAAGCCCTTTGTTCCAGTTAG
TAAACCTGGTGGTCATGGTGTAATTTGGAAATTGGCTTATGACAAAGGTGTCTTTAACTGGTTTTACGATCATGGAAGAA
AAGGAGCAACCGTTCGGCAAGTTAGTAACGTTGTGGCTGCTACAGATGTTACCCTCTTGGCCCTTGCTGGGATTGGCTTA
CGGTATAATAAGAAACTTGGGTTTGCATCCTGTAAAAGGAATGCTGGAGCAACCGAAGGGATTAATGTTTTGATGGAGAA
GAAGAATTTCGATGGGAAGTGGGAATATGGTATATCGTGCATTGAGTACACAGAATTTGATAAATTCGATATCTCCAACA
GATCACCTTCTTCAAATGGTTTGCAGGCTGATTTTCCTGCCAATACAAACATTCTATATGTAGACTTACATTCGGCCGAG
TTAATTGGGTCAAGCAGTAATGCAAAAAGTTTGCCAAATATGGTTCTCAATACAAAGAAGCGAATTGAGTACCTTGATCA
GTATGGAGACTATCACAGCGTTATGGGTGGTAGATTGGAATGCACGATGCAAAACATAGCAGACAACTTTTTTAATAAGT
TTCCATCTAGATGCCACGGCAGTCTAGAAGACAAACTGGATACATATATTGTGTACAACGAACGAAGAAAGGTCACTTCA
TCAGCTAAGAAGAAGAAACCACACGCAAGTGCTGCATTACACCAGACTCCAGATGGTGCATTGTTGGATATACTCCGGAA
TGGATATGACCTCCTTACGGAGTGTGATATCAAACTCCCCATGATTGAAGCTAATGATAAATATGTTGATTCCCCACCTC
CGTATCTCATTCTTCTGCATCCTGCCCTCGGCCCTCTTTGGGAAGTTTCGAGACAGAAATTCAAGGGAGGGTCCATTTCC
AGTTGCTCAGAACTGCAACTAGAGATTGCAGAGTTCTCATGGAACAATGTTCAGGTTGATGGTAGCTTGATCGTTACTGC
TGAAAATGCCATGGGTTCAACAACACCTAATGATAATGGTGAACCAATATTGCAATACGGGTTAAGGTGTGGTAAGTGTA
AACTGCATAACGTGAACGTAGTGAACCGAGGAATCGATTGGAACAGTAAATCAAATGTTTACTGGAGAAACGATGTGAAC
AGGCTTGAGACCTGTAAAATCATACTGCACGGAAATGCAGAATTCGAAGCCAGCAATGTAACTATAGAGGGACACCATGT
TTTTGAAGTACCCGACGGTCACAAACTGAAGATCACATCAGGAAATGCAGGTTTAAGCATCAACTTGGAAGCACTGAAAG
AAGAGGTAATGGAAACAGGAAGCTGGTATTGGAACTACCAACTCAATGGATCCCATATTCATCTTCAACAAGTAGAGGTT
TCACAAAGCTAA