Details for Arabidopsis Locus AT3G56010

Position : Chr3 ( 5`- 20788670 .. 20789924 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G56010

Protein [Map View]
MSVVLNAGFSSPLQNRSHHVIQLKPSPFASYISLNSSRRSLLCKRRLVVSCLDTNDNSVTTTSVDSSSSSDSNKPVSESV
ESSNGTAKKAPLTARERLRAARVLSRYTEATPKPSKPKMGSQLLDVLKESDKKSKRKPGLPEAPTNMLDDSRRGMPKSGL
TFDLPGGSDILIIAFSFVFISTVMFATTFLVWKLGAIHFNE*

DNA
ATGTCCGTCGTTCTCAACGCCGGCTTCAGTTCTCCGCTTCAAAACAGATCACATCATGTTATACAGTTAAAGCCTTCGCC
TTTTGCGTCATACATATCTCTAAACAGTTCAAGAAGGTCACTGTTATGCAAAAGAAGATTGGTTGTATCTTGTTTGGATA
CAAATGACAATTCTGTCACAACTACATCCGTAGATTCTTCTTCTTCTTCAGATTCTAATAAACCAGTAAGTGAATCAGTT
GAATCAAGCAATGGCACTGCCAAAAAAGCACCATTGACAGCACGAGAGAGACTAAGAGCGGCTCGTGTTCTTAGCCGATA
CACTGAAGCAACACCGAAACCGTCAAAACCTAAAATGGGGAGCCAACTTCTTGATGTGCTCAAGGAAAGTGATAAGAAAT
CAAAGAGGAAACCGGGTCTACCCGAAGCACCAACTAACATGCTTGATGATAGCAGGAGAGGGATGCCAAAGAGCGGTCTT
ACGTTTGATTTACCGGGAGGCTCGGATATTCTCATCATTGCTTTCTCCTTTGTGTTCATAAGCACAGTCATGTTTGCTAC
TACTTTTCTTGTTTGGAAACTCGGTGCGATACACTTCAACGAATAG