Details for Arabidopsis Locus AT3G55980

Position : Chr3 ( 5`- 20776295 .. 20778842 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55980

Protein [Map View]
MCSGPKSNLCSSRTLTEIESRQKEEETMLLLEFAACDDLDSFKREVEEKGLDLDESGLWYCRRVGSKKMGLEERTPLMVA
AMYGSIKVLTFIVSTGKSDVNRACGEERVTPLHCAVAGCSVNMIEVINVLLDASALVNSVDANGNQPLDVFVRVSRFVAS
PRRKAVELLLRGGGVGGLIDEAVEEEIKIVSKYPADASLPDINEGVYGSDEFRMYSFKVKPCSRAYSHDWTECAFVHPGE
NARRRDPRKYPYTCVPCPEFRKGSCPKGDSCEYAHGVFESWLHPAQYKTRLCKDETGCARKVCFFAHKREEMRPVNASTG
SAVAQSPFSSLEMMPGLSPLAYSSGVSTPPVSPMANGVPSSPRNGGSWQNRVNTLTPPALQLNGGSRLKSTLSARDIDME
MEMELRLRGFGNNVEETFGSYVSSPSRNSQMGQNMNQHYPSSPVRQPPSQHGFESSAAAAVAVMKARSTAFAKRSLSFKP
ATQAAPQSNLSDWGSPNGKLEWGMKGEELNKMRRSVSFGIHGNNNNNAARDYRDEPDVSWVNSLVKDSTVVSERSFGMNE
RVRIMSWAEQMYREKEQTVV*

DNA
ATGTGCAGTGGACCAAAGAGCAATCTCTGCTCTTCAAGAACCTTAACAGAAATCGAATCAAGGCAAAAGGAAGAAGAAAC
AATGCTTCTCCTCGAATTCGCTGCTTGTGATGATCTTGACTCGTTCAAGAGAGAGGTTGAAGAGAAAGGGCTTGATTTGG
ATGAGTCAGGGTTATGGTATTGCAGACGTGTCGGTTCTAAGAAGATGGGTCTTGAAGAAAGAACACCTTTAATGGTTGCA
GCTATGTATGGAAGCATAAAGGTTTTGACTTTCATCGTTTCCACTGGAAAATCTGATGTGAACAGAGCTTGTGGTGAAGA
GAGAGTTACTCCGCTTCACTGTGCTGTTGCTGGCTGTTCTGTGAATATGATTGAAGTCATCAATGTCTTGCTTGATGCTT
CTGCTTTGGTTAACTCTGTTGATGCTAATGGGAATCAACCTTTGGATGTGTTTGTTCGAGTTTCGAGGTTTGTGGCTAGT
CCGAGGAGGAAAGCGGTTGAGTTGTTGCTGAGAGGAGGAGGTGTTGGAGGATTGATCGATGAGGCGGTTGAAGAAGAGAT
CAAGATTGTCTCTAAGTATCCAGCTGATGCTTCTTTACCGGATATAAACGAAGGGGTTTATGGAAGTGATGAGTTTAGGA
TGTATAGCTTTAAGGTTAAGCCATGTTCTAGGGCTTATTCTCATGATTGGACCGAGTGTGCTTTTGTTCATCCGGGAGAA
AATGCGAGGAGGAGAGATCCGAGGAAGTATCCTTACACTTGTGTCCCCTGTCCCGAGTTCCGTAAAGGATCATGCCCGAA
AGGAGATTCTTGCGAGTATGCTCACGGGGTTTTCGAGTCGTGGCTTCACCCCGCGCAGTATAAAACCCGGCTTTGTAAAG
ATGAAACGGGTTGTGCAAGGAAAGTTTGTTTCTTTGCTCATAAACGCGAAGAGATGAGACCTGTTAATGCTTCAACTGGC
TCTGCCGTGGCTCAGTCTCCGTTTAGCAGCTTGGAGATGATGCCAGGGTTGTCTCCTCTTGCTTATTCTTCAGGAGTTTC
GACTCCTCCGGTTTCTCCAATGGCTAATGGTGTTCCTTCCTCTCCAAGAAACGGCGGATCATGGCAGAACAGAGTCAATA
CCCTTACTCCACCGGCTTTGCAGCTCAATGGTGGAAGCAGATTGAAGTCCACACTGAGCGCTAGAGATATCGATATGGAG
ATGGAGATGGAATTGAGACTCCGCGGTTTTGGCAACAATGTGGAAGAGACGTTCGGGTCTTATGTTTCCTCTCCAAGTAG
GAATTCTCAAATGGGTCAAAACATGAACCAACATTATCCATCTTCCCCGGTGAGACAACCGCCATCTCAACACGGGTTCG
AATCTTCAGCAGCTGCAGCGGTTGCAGTGATGAAAGCGAGATCAACCGCCTTTGCGAAACGTAGCTTGAGCTTCAAACCA
GCTACTCAAGCAGCACCACAGTCGAATCTCTCGGATTGGGGATCTCCAAACGGGAAGCTGGAATGGGGAATGAAAGGAGA
AGAGCTGAATAAGATGAGAAGAAGTGTTTCCTTTGGAATCCATGGAAACAACAACAATAACGCAGCTAGAGACTACAGGG
ACGAGCCAGATGTGTCATGGGTTAACTCTTTAGTTAAAGACAGTACTGTGGTGTCTGAGAGAAGCTTTGGAATGAATGAG
AGGGTTCGGATAATGTCGTGGGCTGAGCAAATGTACAGAGAGAAGGAGCAGACTGTGGTGTAA