Details for Arabidopsis Locus AT3G55970

Position : Chr3 ( 5`- 20766735 .. 20769324 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55970

Protein [Map View]
MNIFQDWPEPIVRVQSLSESNLGAIPNRYVKPLSQRPNITPHNKHNPQTTTIPIIDLGRLYTDDLTLQAKTLDEISKACR
ELGFFQVVNHGMSPQLMDQAKATWREFFNLPMELKNMHANSPKTYEGYGSRLGVEKGAILDWSDYYYLHYQPSSLKDYTK
WPSLPLHCREILEDYCKEMVKLCENLMKILSKNLGLQEDRLQNAFGGKEESGGCLRVNYYPKCPQPELTLGISPHSDPGG
LTILLPDEQVASLQVRGSDDAWITVEPAPHAFIVNMGDQIQMLSNSIYKSVEHRVIVNPENERLSLAFFYNPKGNVPIEP
LKELVTVDSPALYSSTTYDRYRQFIRTQGPRSKCHIDELKSPR*

DNA
ATGAATATCTTCCAAGACTGGCCTGAGCCTATAGTCCGTGTCCAATCCTTATCTGAAAGCAACCTCGGAGCCATACCAAA
TCGCTACGTCAAGCCTCTATCTCAGCGTCCAAACATAACCCCTCACAACAAACACAACCCTCAGACCACCACCATCCCCA
TCATTGACTTAGGTCGCCTATACACGGACGACCTAACTCTACAAGCCAAAACGCTTGATGAAATCTCAAAGGCTTGTAGA
GAATTGGGATTTTTCCAAGTGGTGAACCACGGGATGAGTCCTCAGCTCATGGACCAAGCTAAAGCAACATGGAGAGAATT
CTTTAATCTCCCCATGGAACTCAAAAATATGCATGCTAATTCGCCGAAAACTTACGAGGGATATGGAAGCCGACTAGGCG
TAGAAAAGGGTGCTATTCTTGATTGGAGCGACTACTATTATCTCCATTACCAGCCTTCGTCTTTGAAGGATTACACCAAG
TGGCCTTCCTTGCCTCTTCATTGCCGAGAAATATTGGAGGATTATTGCAAGGAAATGGTGAAACTATGCGAGAACTTGAT
GAAAATCTTATCCAAAAACTTGGGATTACAAGAAGACAGACTTCAAAATGCATTTGGTGGTAAAGAGGAATCAGGTGGAT
GTTTAAGGGTTAATTATTACCCAAAATGCCCTCAACCGGAGCTGACTCTCGGTATCTCTCCGCACTCTGATCCCGGCGGT
TTGACCATTCTCTTGCCGGACGAACAAGTCGCCAGTCTTCAGGTCCGTGGATCCGACGACGCTTGGATCACAGTCGAACC
AGCTCCTCATGCTTTCATCGTTAACATGGGTGACCAAATTCAGATGCTGAGCAATTCAATATACAAAAGCGTAGAACACA
GAGTGATCGTGAACCCTGAAAATGAGAGGTTGTCATTGGCATTTTTCTACAACCCAAAGGGCAATGTTCCTATCGAGCCA
TTGAAGGAGCTAGTGACCGTAGATTCACCTGCTCTCTACTCCTCCACCACATACGATCGTTACCGTCAATTCATTCGTAC
GCAAGGCCCACGTAGCAAATGTCATATTGACGAACTTAAATCCCCTCGATAG