Details for Arabidopsis Locus AT3G55950

Position : Chr3 ( 5`- 20753691 .. 20756395 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55950

Protein [Map View]
MKRFINSTVTFSVTVTIAVIIFFLLSPVTSLGSGSTYAVVYGSDTVCALISGQPTQRILCYDTRLNINVTLNPGVSFSSI
AAGDNFLCGIRSGGYSLLCWDNIGSYSPNRKRIYQNDNVLLETLSVGDKQICATVNGTNSLKCWRGSVSDQSKPPNERFR
SISSGVGFSCGVSIRNNRILCWGTDPVKSNQIQTGFGNTPMVTISAGKSHACGLNTTGNLICIGNNDSGQLNVIAPDQPN
LYSSSLSLGSNFTCAMRISNNSVVCWGGGAERFNNVTDSISFESISSGPGLICGLISSNLSIMCWNPTNFSRIFLPFPEV
LPGPCVESSSSSLCSCGVYPQSDKLCSGTGSICKSCPIQFPASPPSQFPLPPPPPPPPPSPSTSSPPSKALTRGLLAFAI
VGSVGAFAGICSVVYCLWTGVCLGKKKVHNSVQPTITRGGSNSRSNSSNSRSLSIRRQGSRMLSMRRQRSGTSSMKHADK
AEEFSFSELASATGNFSLENKIGSGSFGVVYRGKLNDGREVAIKRGEVNAKMKKFQEKETAFDSEIAFLSRLHHKHLVRL
VGYCEEREEKLLVYDYMKNGALYDHLHDKNNVEKHSSLINSWKMRIKIALDAARGIEYLHNYAVPPIIHRDIKSSNILLD
SNWVARVSDFGLSLMGPVLGKDHNPYQRPTKAAGTVGYIDPEYYSLNVLTDKSDVYGLGVVLLELLTGKRAIFRNNGDVE
EEEGCVPVHLVDYSVPAITADELSTILDPRVGSPELGEGDAVELVAYTAMHCVNAEGRNRPTMTDIVGNLERALDLCGDS
HGSISSGICSIVSD*

DNA
ATGAAGAGGTTTATCAACTCAACCGTGACGTTTTCCGTCACCGTCACCATCGCCGTTATCATCTTCTTCCTCTTGTCTCC
CGTCACCTCCTTAGGTTCAGGCTCAACTTACGCAGTCGTATACGGCTCCGACACCGTCTGCGCATTGATCTCCGGTCAAC
CCACACAACGTATCCTCTGTTACGACACGCGTCTTAATATCAACGTCACTCTAAACCCCGGCGTCTCATTCTCCTCAATA
GCCGCCGGAGATAATTTCCTCTGCGGTATACGCTCCGGTGGTTACAGCCTTCTCTGTTGGGATAACATCGGAAGCTACTC
TCCAAACCGGAAACGAATCTACCAAAACGACAACGTTTTACTCGAGACTCTCTCCGTCGGGGATAAACAAATCTGCGCAA
CCGTTAACGGTACAAATTCCTTAAAATGCTGGAGAGGTTCCGTTTCCGATCAATCAAAACCTCCGAACGAGAGATTCCGA
TCAATTTCATCCGGCGTTGGTTTCTCCTGCGGCGTTTCGATTCGAAATAACCGAATCCTTTGCTGGGGAACCGATCCGGT
TAAATCGAATCAGATCCAAACCGGATTCGGAAACACGCCGATGGTGACCATCTCCGCAGGTAAATCACACGCTTGTGGAT
TAAACACTACTGGGAATTTGATTTGCATCGGAAACAACGATTCTGGTCAGCTCAATGTTATTGCTCCAGATCAACCTAAC
CTTTACTCATCATCTCTCTCTCTCGGATCAAATTTCACCTGCGCGATGCGAATCTCGAATAATTCTGTGGTTTGTTGGGG
CGGAGGAGCAGAGAGATTCAACAATGTCACGGATTCGATCTCTTTCGAATCGATTTCCTCGGGTCCGGGTCTAATTTGCG
GGTTGATTTCAAGTAATCTCTCAATCATGTGTTGGAATCCTACAAATTTCTCCAGAATCTTCCTCCCTTTCCCAGAAGTT
TTACCAGGTCCTTGCGTTGAATCATCATCATCCTCTCTTTGCTCTTGTGGTGTTTATCCACAATCTGATAAGCTCTGTTC
TGGTACTGGCTCGATTTGTAAATCATGTCCGATTCAATTTCCAGCGAGTCCTCCGAGTCAATTTCCTCTTCCACCACCAC
CACCACCACCACCGCCATCACCGTCAACTTCATCTCCACCGTCGAAAGCTTTAACAAGAGGATTATTAGCGTTTGCGATC
GTTGGATCAGTTGGAGCATTTGCAGGGATCTGTAGTGTGGTTTACTGTTTATGGACTGGAGTTTGCTTGGGGAAGAAGAA
AGTTCATAACTCGGTTCAACCGACGATAACTCGCGGTGGTTCTAATAGCCGGTCTAACAGTTCGAATAGCCGGTCGTTAT
CTATAAGACGTCAAGGATCGAGAATGCTATCAATGAGGAGGCAGAGAAGTGGAACATCGTCGATGAAGCACGCCGATAAA
GCGGAAGAGTTTTCGTTCTCCGAGCTTGCTTCGGCTACCGGAAACTTCTCTCTAGAGAACAAAATCGGTTCGGGGAGCTT
TGGTGTTGTTTACAGAGGTAAACTCAATGACGGGAGAGAAGTAGCGATCAAACGCGGGGAAGTAAACGCGAAGATGAAGA
AGTTTCAAGAGAAAGAAACCGCGTTTGATTCGGAAATCGCGTTTTTATCGAGGCTTCATCATAAGCATTTGGTGAGACTA
GTTGGTTACTGCGAAGAAAGAGAAGAGAAGCTTCTCGTTTACGATTACATGAAGAATGGTGCGCTTTACGATCATCTACA
CGACAAGAACAACGTCGAAAAACATAGTAGCTTGATCAATTCTTGGAAAATGCGGATCAAAATCGCGTTAGATGCGGCTA
GAGGAATCGAGTATCTACATAACTACGCAGTGCCACCGATTATTCATAGAGATATTAAGTCGTCTAACATCTTGCTTGAC
TCTAATTGGGTCGCTAGAGTTTCGGATTTCGGGTTATCATTAATGGGTCCGGTGCTAGGGAAAGATCATAATCCTTATCA
ACGTCCAACGAAAGCTGCGGGGACGGTCGGATATATTGATCCAGAGTATTATAGTCTTAATGTTTTAACGGATAAGAGCG
ATGTGTATGGACTAGGAGTGGTGTTGTTAGAATTGTTGACCGGGAAAAGAGCGATATTTAGGAACAATGGTGATGTGGAG
GAGGAGGAAGGGTGTGTTCCGGTGCATTTGGTGGATTACTCGGTTCCGGCGATAACGGCTGATGAGTTGAGTACAATTTT
GGATCCGAGAGTTGGATCACCGGAGCTAGGTGAAGGAGATGCGGTGGAGCTGGTGGCTTATACGGCTATGCATTGTGTGA
ATGCGGAAGGGAGAAACAGGCCGACAATGACGGATATAGTAGGGAATTTGGAGAGAGCATTGGATTTGTGTGGGGATAGT
CATGGGAGTATCTCTAGTGGCATTTGTTCTATTGTCTCTGATTGA