Details for Arabidopsis Locus AT3G55870

Position : Chr3 ( 5`- 20730858 .. 20733903 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55870

Protein [Map View]
MIKRLQVSFSNLLSQDITLPLFVVGAHPKMEIVAKENKVTVMDHVKGTKTTEEVEDPMMIPRRISETWKPQLIDDLPDVF
CGGWVGYFSYDTVPYAEKRKLPLSKAPVDDRNLPDMHLGLYDDVVVFDHVEKKIHIIHWVRLSENSSFDDVYANAVKHLE
ELVSRIKCMNPPKLPYGSVDLHTNQFGTPLEKSSMTSDAYKNAVLQAKEHILAGDIFQIVLSQRFERHTFAHPFEVYRAL
RIVNPSPSMCYLQARGCILVASSPEILTRVKKNKIVNRPLAGTARRGKSFEEDQMLEEALLKDEKQCAEHIMLVDLGRND
VGKVSKNGSVKVERLMNIERYSHVMHISSTVIGELQENLTCWDTLRAALPVGTVSGAPKVKAMELIDELEVTRRGPYSGG
FGSVSFTGDMDIALALRTIVFPTQARYDTMYSYKDKDTPRREWIAYLQAGAGIVADSDPEDEHRECQNKAAGLARAIDLA
ESAFVDKSDTTI*

DNA
ATGATCAAGAGGCTCCAAGTTTCCTTTTCGAATCTGTTGAGCCAGGACATCACTCTTCCACTGTTTGTCGTTGGAGCGCA
TCCGAAAATGGAAATTGTGGCAAAGGAGAATAAAGTTACAGTCATGGATCATGTGAAAGGCACTAAGACTACAGAGGAAG
TTGAAGATCCAATGATGATTCCTAGAAGAATCTCAGAGACTTGGAAACCACAATTGATCGATGATCTTCCTGATGTTTTT
TGTGGTGGATGGGTTGGTTACTTTTCTTATGATACTGTTCCCTATGCCGAAAAGCGAAAGCTACCTCTCTCAAAGGCTCC
GGTTGATGACCGAAATTTACCAGATATGCATCTTGGTCTTTATGATGATGTGGTTGTGTTTGATCATGTCGAAAAGAAAA
TACATATAATTCATTGGGTGAGGTTATCAGAAAACTCATCATTTGATGATGTTTATGCTAATGCTGTGAAACACTTGGAA
GAACTTGTTTCGAGGATCAAATGCATGAATCCCCCCAAGCTACCTTATGGATCAGTGGACTTGCACACAAATCAATTTGG
CACTCCTTTGGAAAAATCAAGCATGACAAGTGATGCATATAAGAATGCTGTACTTCAAGCCAAAGAACACATACTGGCTG
GAGATATCTTTCAGATTGTTTTAAGTCAAAGATTTGAGCGCCACACTTTTGCCCATCCGTTTGAAGTTTATCGAGCTTTG
AGAATTGTGAACCCAAGTCCTTCTATGTGTTACTTGCAAGCAAGAGGTTGTATTCTAGTAGCGTCAAGTCCTGAGATTCT
CACTAGAGTGAAGAAAAACAAGATCGTGAATAGACCACTAGCAGGAACTGCAAGACGAGGAAAGAGTTTCGAGGAGGATC
AAATGTTGGAGGAGGCACTTTTAAAAGATGAAAAACAGTGTGCAGAACACATCATGCTCGTTGACTTGGGTCGCAATGAT
GTTGGAAAGGTGTCCAAGAACGGCTCAGTGAAAGTAGAAAGGCTCATGAATATAGAGCGTTATTCTCATGTCATGCATAT
TAGCTCAACGGTGATTGGAGAGTTGCAAGAGAATCTGACTTGCTGGGACACGCTTCGTGCTGCTTTACCCGTTGGAACCG
TTAGCGGAGCTCCAAAGGTGAAGGCTATGGAGTTGATCGATGAGCTAGAGGTGACTAGAAGAGGTCCATATAGTGGTGGA
TTCGGTAGTGTCTCATTCACTGGAGACATGGACATAGCTTTGGCTCTTAGGACCATTGTGTTCCCAACACAAGCTCGTTA
CGACACAATGTACTCATACAAAGACAAAGACACGCCACGCCGTGAGTGGATAGCCTATCTACAAGCAGGTGCAGGCATTG
TAGCTGATAGTGACCCAGAGGATGAGCACCGTGAGTGTCAGAACAAAGCTGCTGGGCTAGCACGTGCCATTGACTTGGCT
GAGTCTGCATTCGTTGATAAAAGTGATACAACAATCTAG